DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and UGT76C2

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_196205.1 Gene:UGT76C2 / 830471 AraportID:AT5G05860 Length:450 Species:Arabidopsis thaliana


Alignment Length:439 Identity:97/439 - (22%)
Similarity:161/439 - (36%) Gaps:135/439 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIISMSVAKILAEQGHNVTVVTV---LEPTITHKNINLVTVP--MTKEEIKQRSET 89
            |||......:...:.:|.||..:|.::||:..   .....:|.....:.:|  :::.||:....:
plant    12 LFPLPLQGCINPMLQLANILHVRGFSITVIHTRFNAPKASSHPLFTFLQIPDGLSETEIQDGVMS 76

  Fly    90 IGAKQKNTSSNRFISILNMSGQMDSMLRK-MADVLKDQRV----------------KELYLNKDN 137
            :.| |.|         ||........||| :.:..:.:||                :.|.|.:  
plant    77 LLA-QIN---------LNAESPFRDCLRKVLLESKESERVTCLIDDCGWLFTQSVSESLKLPR-- 129

  Fly   138 HFDLVISGY---FMNDY-QLGFAR-KVNAPVV------VLAPSPPSQM--LNSLIGNPHDKVEKE 189
               ||:..:   |.|.| .|...| |...||.      .:...||.|.  |:.:.|.        
plant   130 ---LVLCTFKATFFNAYPSLPLIRTKGYLPVSESEAEDSVPEFPPLQKRDLSKVFGE-------- 183

  Fly   190 KGMTFGQRLDSYI----------SSLLYGIFLRQIDQRNRQYYNEIFGDDPTMPEYTDILRNTSL 244
                ||::||.::          |.|:| :...::::.:....||||    .:|.:       ::
plant   184 ----FGEKLDPFLHAVVETTIRSSGLIY-MSCEELEKDSLTLSNEIF----KVPVF-------AI 232

  Fly   245 VFFCSH-AASEGPIRPSVPAAIEIGGIQIKDKPDPLPKNLEKFLGNATHGAILLSLGSNVQGSHI 308
            ..|.|: :||...:.......|    :.:.|:.|              ...|.:||||.|   :|
plant   233 GPFHSYFSASSSSLFTQDETCI----LWLDDQED--------------KSVIYVSLGSVV---NI 276

  Fly   309 KADTVKKIFSVLSNLKQRVIW----------KWDDLDKTPGKSDNILYS--------RWLPQDDI 355
            ......:|...|||.||..:|          ||.:     ..|:.::.|        :|.||.::
plant   277 TETEFLEIACGLSNSKQPFLWVVRPGSVLGAKWIE-----PLSEGLVSSLEEKGKIVKWAPQQEV 336

  Fly   356 LAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAMVKSGF 404
            |||.:...|:.|.|.....|:...|.||:.||...||      |:.|.|
plant   337 LAHRATGGFLTHNGWNSTLESICEGVPMICLPGGWDQ------MLNSRF 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 97/439 (22%)
UGT76C2NP_196205.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 97/439 (22%)
YjiC 9..429 CDD:224732 97/439 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.