DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and UGT73B2

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_567954.1 Gene:UGT73B2 / 829560 AraportID:AT4G34135 Length:483 Species:Arabidopsis thaliana


Alignment Length:474 Identity:95/474 - (20%)
Similarity:173/474 - (36%) Gaps:109/474 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FPSLSPSHLIISMSVAKILAEQGHNVTVVT-------VLEPTITHKNIN--------LVTVPMTK 80
            ||.::..|:|.::.:||:.:.:|...|::|       :.:|..|.||:|        :...|..:
plant    15 FPFMAYGHMIPTLDMAKLFSSRGAKSTILTTSLNSKILQKPIDTFKNLNPGLEIDIQIFNFPCVE 79

  Fly    81 EEIKQRSETIGAKQKNTSSNR-------FISILNMSGQMDSMLRKMADVLKDQRVKELYL----- 133
            ..:.:..|.:.....|.:.::       |.|......|::.:|   .....|..:.:::.     
plant    80 LGLPEGCENVDFFTSNNNDDKNEMIVKFFFSTRFFKDQLEKLL---GTTRPDCLIADMFFPWATE 141

  Fly   134 --NKDNHFDLVI--SGYFMNDYQLGFARKVNAPVVVLAPSPPSQMLNSLIGN---PHDKV----- 186
              .|.|...||.  :|||  ....|:...|:.|...:|.|....::..|.||   ..:::     
plant   142 AAGKFNVPRLVFHGTGYF--SLCAGYCIGVHKPQKRVASSSEPFVIPELPGNIVITEEQIIDGDG 204

  Fly   187 EKEKGMTFGQRLDSYISSLLYGIFLRQIDQRNRQYYNEIFGDDPTMPEYTDILRNTSLVFFC--S 249
            |.:.|....:..:|.:.|  .|:.|      |..|..|        .:|.|..::      |  .
plant   205 ESDMGKFMTEVRESEVKS--SGVVL------NSFYELE--------HDYADFYKS------CVQK 247

  Fly   250 HAASEGPIRPSVPAAIEIGGIQIK---------DKPDPLPKNLEKFL-GNATHGAILLSLGS--- 301
            .|...||:      ::...|.:.|         |:.:.|     |:| ....:..|.:|.||   
plant   248 RAWHIGPL------SVYNRGFEEKAERGKKANIDEAECL-----KWLDSKKPNSVIYVSFGSVAF 301

  Fly   302 --NVQ----GSHIKADTVKKIFSVLSNLKQRVIWKWDDLDKTPGKSDNILYSRWLPQDDILAHPS 360
              |.|    .:.::|.....|:.|......|..|..:..::.. |...::...|.||..||.|.:
plant   302 FKNEQLFEIAAGLEASGTSFIWVVRKTKDDREEWLPEGFEERV-KGKGMIIRGWAPQVLILDHQA 365

  Fly   361 VKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAM-------VKSGFGLTLSLLT---LEE 415
            ...|:.|.|...:.|....|.||::.||..:|..|...:       |..|....:.::.   :..
plant   366 TGGFVTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLRTGVSVGASKHMKVMMGDFISR 430

  Fly   416 EPFRAAVLEILSNPKYSQR 434
            |....||.|:|:.....:|
plant   431 EKVDKAVREVLAGEAAEER 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 95/474 (20%)
UGT73B2NP_567954.1 PLN03007 5..483 CDD:178584 95/474 (20%)
MGT 15..441 CDD:273616 93/464 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2282
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.