DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and AT4G15260

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_193261.2 Gene:AT4G15260 / 827192 AraportID:AT4G15260 Length:359 Species:Arabidopsis thaliana


Alignment Length:181 Identity:42/181 - (23%)
Similarity:75/181 - (41%) Gaps:41/181 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 VPAAIEIGGI-QIKDKPDPLPKNLE--KFLGNATHGAIL-LSLGSNVQGSHIKADTVKKIFSVLS 321
            :|.|..:|.: .:.:..|...|.||  ::|.:....::| |..||  .|...:..| :::...|:
plant   116 LPQAYPVGPVLHLDNGDDDDEKRLEVLRWLDDQPPKSVLFLCFGS--MGGFTEEQT-REVAVALN 177

  Fly   322 NLKQRVIWKWDDLDKTPGKSDNILYSR---------------------------WLPQDDILAHP 359
            ....|.:|   .|.:.   |.||:..|                           |.||..:|..|
plant   178 RSGHRFLW---SLRRA---SPNIMMERPGDYKNLEEVLPDGFLERTLDRGKVIGWAPQVAVLEKP 236

  Fly   360 SVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAMVKSGFGLTLSL 410
            ::..|:.|.|...:.|:.:.|.||::.|::.:|..||..||:. .||.:.:
plant   237 AIGGFVTHCGWNSMLESLWFGVPMVTWPLYAEQKVNAFEMVEE-LGLAVEI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 42/181 (23%)
AT4G15260NP_193261.2 Glycosyltransferase_GTB_type <1..359 CDD:299143 42/181 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.