DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and AT4G14090

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_193146.1 Gene:AT4G14090 / 827046 AraportID:AT4G14090 Length:456 Species:Arabidopsis thaliana


Alignment Length:279 Identity:56/279 - (20%)
Similarity:101/279 - (36%) Gaps:79/279 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 YNEIFGDDPTMPEYTDILRNTSLVFFCSHAASEGPIRPS--VPAAIEIGGIQIKDKPDPL----- 279
            |..:|..:|.......::....|..|         ::||  :|:|:    :.:::..:.|     
plant   159 YKHLFDVEPIKLPKLPLITTGDLPSF---------LQPSKALPSAL----VTLREHIEALETESN 210

  Fly   280 PKNLEKFLGNATHGAI-------LLSLGSNVQGSHIKADTVKKIFS-----VLSNLKQRVIW--- 329
            ||.|........|.|:       ::.:|..|..|..|.|..|....     :.|.|::.||:   
plant   211 PKILVNTFSALEHDALTSVEKLKMIPIGPLVSSSEGKTDLFKSSDEDYTKWLDSKLERSVIYISL 275

  Fly   330 --KWDDL------------------------DKTPGK------------SDNILYSRWLPQDDIL 356
              ..|||                        :|.|.:            ||..|...|..|..:|
plant   276 GTHADDLPEKHMEALTHGVLATNRPFLWIVREKNPEEKKKNRFLELIRGSDRGLVVGWCSQTAVL 340

  Fly   357 AHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAMVKSGFGLTLSLLTLEE-----E 416
            ||.:|..|:.|.|.....|:...|.|:::.|.|.||...| .:|:..:.:.:.:...||     |
plant   341 AHCAVGCFVTHCGWNSTLESLESGVPVVAFPQFADQCTTA-KLVEDTWRIGVKVKVGEEGDVDGE 404

  Fly   417 PFRAAVLEILSNPKYSQRV 435
            ..|..:.:::|..:.::.:
plant   405 EIRRCLEKVMSGGEEAEEM 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 56/279 (20%)
AT4G14090NP_193146.1 YjiC 11..445 CDD:224732 56/279 (20%)
Glycosyltransferase_GTB_type 12..454 CDD:299143 56/279 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.