DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and UGT71B6

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_188815.2 Gene:UGT71B6 / 821732 AraportID:AT3G21780 Length:479 Species:Arabidopsis thaliana


Alignment Length:444 Identity:98/444 - (22%)
Similarity:171/444 - (38%) Gaps:108/444 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGLFPSLSPSHLIISMSVAKILAEQGHNVTVVTVLEPTITHKNINLVTVPMTKEEIKQRSETI-G 91
            |...||.:.|||:.::.:|:.|.::..|:: :||:..:.:.||.:::|...:...:  |.|.| |
plant     5 LVFIPSPAISHLMATVEMAEQLVDKNDNLS-ITVIIISFSSKNTSMITSLTSNNRL--RYEIISG 66

  Fly    92 AKQKNT---SSNRFISILN------MSGQMDSML---------------RKMADVLKDQRVKE-- 130
            ..|:.|   :::..|..|.      ::..:||.|               ..|.||..:..|..  
plant    67 GDQQPTELKATDSHIQSLKPLVRDAVAKLVDSTLPDAPRLAGFVVDMYCTSMIDVANEFGVPSYL 131

  Fly   131 LYLNKDNHFDLVISGYFMND----YQLGFARKVNAPVVV---LAPSPPSQMLNSLIGNPHDKVEK 188
            .|.:......|::...||.|    |.:......:..:||   .:|.|    |..|   |:....|
plant   132 FYTSNAGFLGLLLHIQFMYDAEDIYDMSELEDSDVELVVPSLTSPYP----LKCL---PYIFKSK 189

  Fly   189 EKGMTFGQRLDSYISSLLYGIFLRQIDQRNRQYYNEIFGDDPTMPEYTDILRNTSLVFFCSHAAS 253
            | .:||               |:.|. :|.|:....:..   |:|:    |...:|.|.     |
plant   190 E-WLTF---------------FVTQA-RRFRETKGILVN---TVPD----LEPQALTFL-----S 225

  Fly   254 EGPIRPSVPAAIEIGG-IQIK----DKPDPLPKNLEKFLG-NATHGAILLSLGSNVQGSHIKADT 312
            .|    ::|.|..:|. :.:|    |..|.....:.::|. ......:.|..||  .|. ...:.
plant   226 NG----NIPRAYPVGPLLHLKNVNCDYVDKKQSEILRWLDEQPPRSVVFLCFGS--MGG-FSEEQ 283

  Fly   313 VKKIFSVLSNLKQRVIWKW-----DDLDKTPGKSDNI-------LYSR---------WLPQDDIL 356
            |::....|.....|.:|..     :.|.:.||:..|:       .:.|         |..|..||
plant   284 VRETALALDRSGHRFLWSLRRASPNILREPPGEFTNLEEILPEGFFDRTANRGKVIGWAEQVAIL 348

  Fly   357 AHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAMVKSGFGLTLSL 410
            |.|::..|::|.|.....|:.:.|.||...|::.:|..||..||:. .||.:.:
plant   349 AKPAIGGFVSHGGWNSTLESLWFGVPMAIWPLYAEQKFNAFEMVEE-LGLAVEI 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 98/444 (22%)
UGT71B6NP_188815.2 PLN02554 1..473 CDD:215304 98/444 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.