DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and UGT71B1

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_188812.1 Gene:UGT71B1 / 821729 AraportID:AT3G21750 Length:473 Species:Arabidopsis thaliana


Alignment Length:453 Identity:86/453 - (18%)
Similarity:163/453 - (35%) Gaps:106/453 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGLFPSLSPSHLIISMSVAKILAEQGHNVTVVTVLEPTITHKNINLVTVPMTKEEIKQRSETIGA 92
            |...||....|:..:.::||:|....:.::|..::.|:....:.:  :...|..|.:.|...:.|
plant     5 LVFIPSPGVGHIRATTALAKLLVASDNRLSVTLIVIPSRVSDDAS--SSVYTNSEDRLRYILLPA 67

  Fly    93 KQKNTSSNRFISILNMSGQMDSMLRKMADVLKDQRVKELYLNKDNHFDLVISGYFMNDYQLGFAR 157
            :.:.|....:|.  :...|:.:::.|:|.        ::....|:....::...|... .:..|.
plant    68 RDQTTDLVSYID--SQKPQVRAVVSKVAG--------DVSTRSDSRLAGIVVDMFCTS-MIDIAD 121

  Fly   158 KVNAPVVVLAPSPPSQM-LNSLIGNPHDKVE------KEKGMTFG--QRLDSYISSLLYGIFLRQ 213
            :.|....:...|..|.: |...:.:.:|:.|      |:..|.|.  .....:.:..|..:.|  
plant   122 EFNLSAYIFYTSNASYLGLQFHVQSLYDEKELDVSEFKDTEMKFDVPTLTQPFPAKCLPSVML-- 184

  Fly   214 IDQRNRQYYNEIFGDDPTMPEYTDILRNT-------SLVFFCSHAASEGPIRPSVPAAIEIGGIQ 271
                |::::..:.|...:......||.|:       :|.||     |.|....::|....:|.|.
plant   185 ----NKKWFPYVLGRARSFRATKGILVNSVADMEPQALSFF-----SGGNGNTNIPPVYAVGPIM 240

  Fly   272 -----------------IKDKPDPLPKNLEKFLGNATHGAILLSLGSNVQGSHIKADTVKKIFSV 319
                             :|::|              |...:.|..||  .|. ...:..::|...
plant   241 DLESSGDEEKRKEILHWLKEQP--------------TKSVVFLCFGS--MGG-FSEEQAREIAVA 288

  Fly   320 LSNLKQRVIWK-------WDDLDKTPGKSDNI-----------------LYSRWLPQDDILAHPS 360
            |.....|.:|.       .:..:..||:..|:                 :.| |.||.|:|..|:
plant   289 LERSGHRFLWSLRRASPVGNKSNPPPGEFTNLEEILPKGFLDRTVEIGKIIS-WAPQVDVLNSPA 352

  Fly   361 VKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAMVKSGFGLTLSLLT------LEEEP 417
            :..|:.|.|...|.|:.:.|.||.:.|::.:|..||..||.. .||...:..      |.|||
plant   353 IGAFVTHCGWNSILESLWFGVPMAAWPIYAEQQFNAFHMVDE-LGLAAEVKKEYRRDFLVEEP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 86/453 (19%)
UGT71B1NP_188812.1 Glycosyltransferase_GTB_type 1..473 CDD:299143 86/453 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.