DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and UGT73C6

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_181217.1 Gene:UGT73C6 / 818251 AraportID:AT2G36790 Length:495 Species:Arabidopsis thaliana


Alignment Length:437 Identity:91/437 - (20%)
Similarity:164/437 - (37%) Gaps:110/437 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIISMSVAKILAEQGHNVTVVTVLEPTITHKN-----------INLVTVPMTKEEI 83
            |||.::..|:|..:.:|::||::|..:|:||........||           ||||.|....:|.
plant    16 LFPFMAQGHMIPMVDIARLLAQRGVLITIVTTPHNAARFKNVLNRAIESGLPINLVQVKFPYQEA 80

  Fly    84 -----KQRSETIGAKQKNTSSNRFISIL-----NMSGQM---------DSMLRKMADVLKDQRVK 129
                 ::..:.:...::.||..:.:::|     |:..:|         |..|...:::.|..::.
plant    81 GLQEGQENMDLLTTMEQITSFFKAVNLLKEPVQNLIEEMSPRPSCLISDMCLSYTSEIAKKFKIP 145

  Fly   130 ELYLNKDNHFDLVI-----------------SGYFMNDY---QLGFARKVNAPVVVLAPSPPSQM 174
            ::..:....|.|:.                 ..||:..|   ::.|.|. ..||....|:...::
plant   146 KILFHGMGCFCLLCVNVLRKNREILDNLKSDKEYFIVPYFPDRVEFTRP-QVPVETYVPAGWKEI 209

  Fly   175 LNSLIGNPHDKVEKEKGMTFGQRLDSYISSLLYGIFLRQIDQRNRQYYNEIFGDDPTMPEYTDIL 239
            |       .|.||.:|              ..||:.:....:..              |.|....
plant   210 L-------EDMVEADK--------------TSYGVIVNSFQELE--------------PAYAKDF 239

  Fly   240 RNTSLVFFCSHAASEGPIRPSVPAAIEIGGIQIKDKPDPLPKNLEKFLGNATHGAIL-LSLGSNV 303
            :...    ...|.:.||:  |:...:.:...:..:|.|.......::|.:...|::| :.|||. 
plant   240 KEAR----SGKAWTIGPV--SLCNKVGVDKAERGNKSDIDQDECLEWLDSKEPGSVLYVCLGSI- 297

  Fly   304 QGSHIKADTVKKIFSVLSNLKQRVIW------KWDDLDK---TPGKSDNI-----LYSRWLPQDD 354
              .::....:.::...|...::..||      |:.:|.:   ..|..|.|     |...|.||..
plant   298 --CNLPLSQLLELGLGLEESQRPFIWVIRGWEKYKELVEWFSESGFEDRIQDRGLLIKGWSPQML 360

  Fly   355 ILAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAMVK 401
            ||:||||..|:.|.|.....|....|.|||:.|:|.||..|...:|:
plant   361 ILSHPSVGGFLTHCGWNSTLEGITAGLPMLTWPLFADQFCNEKLVVQ 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 91/437 (21%)
UGT73C6NP_181217.1 Glycosyltransferase_GTB-type 12..494 CDD:385653 91/437 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2282
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.