DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and UGT71C2

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_180535.1 Gene:UGT71C2 / 817524 AraportID:AT2G29740 Length:474 Species:Arabidopsis thaliana


Alignment Length:523 Identity:95/523 - (18%)
Similarity:177/523 - (33%) Gaps:188/523 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QGANILGLFPSLSPSHLIISMSVAK-ILAEQGHNVTVVTVLEPTI-----------------THK 69
            |.|.:: ..|...|.|::.::.:|| :::.|...:..:|:|..::                 |..
plant     5 QEAELI-FIPFPIPGHILATIELAKRLISHQPSRIHTITILHWSLPFLPQSDTIAFLKSLIETES 68

  Fly    70 NINLVTVPMTK-----------------EEIKQRSETIGAKQKNTSSNR---------------- 101
            .|.|:|:|..:                 |.:|:....:........|:|                
plant    69 RIRLITLPDVQNPPPMELFVKASESYILEYVKKMVPLVRNALSTLLSSRDESDSVHVAGLVLDFF 133

  Fly   102 FISILNMSGQMD-----------SMLRKMADVLKDQRVKELYLNKDNHFDLVISGYFMNDYQLGF 155
            .:.::::..:.:           |.|..|..:|:..|..:..||:.:..:.:....|:|      
plant   134 CVPLIDVGNEFNLPSYIFLTCSASFLGMMKYLLERNRETKPELNRSSDEETISVPGFVN------ 192

  Fly   156 ARKVNAPVVVLAPS-----------------PPSQMLNSLIGNPHDKVEKEKGMTFGQRLDSY-- 201
                :.||.||.|.                 |.::   .::.|..:.:|:.....|.:|.|:|  
plant   193 ----SVPVKVLPPGLFTTESYEAWVEMAERFPEAK---GILVNSFESLERNAFDYFDRRPDNYPP 250

  Fly   202 ---ISSLLYGIFLRQIDQRNRQYYNEIFGDDPTMPEYTDILRNTSLVFFC-----SHAASEGPIR 258
               |..:|.......:|...|....:...|.|          .:|:||.|     |.|||:  |:
plant   251 VYPIGPILCSNDRPNLDLSERDRILKWLDDQP----------ESSVVFLCFGSLKSLAASQ--IK 303

  Fly   259 PSVPAAIEIGGIQI--------KDKPDP---LPKNLEKFLGNATHGAILLSLGSNVQGSHIKADT 312
             .:..|:|:.||:.        |:...|   ||   :.|:..      ::.||            
plant   304 -EIAQALELVGIRFLWSIRTDPKEYASPNEILP---DGFMNR------VMGLG------------ 346

  Fly   313 VKKIFSVLSNLKQRVIWKWDDLDKTPGKSDNILYSRWLPQDDILAHPSVKLFINHAGKGGISEAQ 377
                                            |...|.||.:||||.::..|::|.|...|.|:.
plant   347 --------------------------------LVCGWAPQVEILAHKAIGGFVSHCGWNSILESL 379

  Fly   378 YHGKPMLSLPVFGDQPGNAHAMVKS-GFGLTLSLLTLEE-------EPFRAAVLEILSNPKYSQR 434
            ..|.|:.:.|::.:|..||..:||. |..|.:.|..:.|       :....||..::......:|
plant   380 RFGVPIATWPMYAEQQLNAFTIVKELGLALEMRLDYVSEYGEIVKADEIAGAVRSLMDGEDVPRR 444

  Fly   435 VVK 437
            .:|
plant   445 KLK 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 94/521 (18%)
UGT71C2NP_180535.1 PLN02167 4..474 CDD:215112 95/523 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.