DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and UGT2B17

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001068.1 Gene:UGT2B17 / 7367 HGNCID:12547 Length:530 Species:Homo sapiens


Alignment Length:570 Identity:149/570 - (26%)
Similarity:258/570 - (45%) Gaps:106/570 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IVLALTLLIYGAQGA--NILGLFPSLSPSHLIISMSVAKILAEQGHNVTVVT----VLEPTITHK 69
            :.|.:.|..|.:.|:  .:| ::|: ..||.|...::.:.|.::||.|.|:|    :|.......
Human     8 VFLLMQLSCYFSSGSCGKVL-VWPT-EYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSS 70

  Fly    70 NINLVTVP--MTKEEI-----KQRSETIGAKQKNTSSNRFISILNMSGQMDSMLRKMADVLKDQR 127
            .|.|...|  :||.::     |.......:..|||..:.|           |.|:::.....|..
Human    71 AIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYF-----------SQLQELCWEYSDYN 124

  Fly   128 VK---ELYLNK-------DNHFDLVISGYFMNDYQLGFARKVNAPVVVLAPSPPSQMLNSLIGNP 182
            :|   :..|||       ::.||::::.                     |.:|..::|..|:..|
Human   125 IKLCEDAVLNKKLMRKLQESKFDVLLAD---------------------AVNPCGELLAELLNIP 168

  Fly   183 H---------DKVEKEKG-------------------MTFGQRLDSYISSLLYGIFLRQIDQRN- 218
            .         ..|||..|                   |.|.:|:.:.|..|.:..:.:..|.:. 
Human   169 FLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKW 233

  Fly   219 RQYYNEIFGDDPTMPEYTDILRNTSLVFFCSHAASEGPIRPSVPAAIEIGGIQIKDKPDPLPKNL 283
            .|:|:|:.|...|:.|   .:....:....::...|.| ||.:|....:||:..| ...||||.:
Human   234 DQFYSEVLGRPTTLFE---TMGKAEMWLIRTYWDFEFP-RPFLPNVDFVGGLHCK-PAKPLPKEM 293

  Fly   284 EKFL-GNATHGAILLSLGSNVQGSHIKADTVKKIFSVLSNLKQRVIWKWDDLDKTPGKSDNILYS 347
            |:|: .:..:|.::.||||.:  |::..::...|.|.|:.:.|:|:|::|      ||..|.|.|
Human   294 EEFVQSSGENGIVVFSLGSMI--SNMSEESANMIASALAQIPQKVLWRFD------GKKPNTLGS 350

  Fly   348 -----RWLPQDDILAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAMVKSGFGLT 407
                 :||||:|:|.||..|.||.|.|..||.||.|||.||:.:|:|.||..|...|...|..|:
Human   351 NTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALS 415

  Fly   408 LSLLTLEEEPFRAAVLEILSNPKYSQRVVKFSSLYRDRPASARESLIFWTEYVIRHHGAAHLQSP 472
            :.:.|:.......|:..::::|.|.:.::|.|.::.|:|....:..:||.|:|:||.||.||:..
Human   416 VDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVA 480

  Fly   473 LVHMDFIAANNLDIYALIGAISIGLLLMLKKVVQITCRRLRTKLNKVKKQ 522
            ..::.:|..::||:.|.:.|....::.|:.|.. :.|.|...|..|.||:
Human   481 AHNLTWIQYHSLDVIAFLLACVATMIFMITKCC-LFCFRKLAKTGKKKKR 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 122/488 (25%)
UGT2B17NP_001068.1 UDPGT 24..518 CDD:278624 140/541 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.