DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and UGT2A2

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001099147.2 Gene:UGT2A2 / 574537 HGNCID:28183 Length:536 Species:Homo sapiens


Alignment Length:565 Identity:141/565 - (24%)
Similarity:242/565 - (42%) Gaps:108/565 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IVLALTLLIYGAQGANILGLFPSLSPSHLIISMSVAKILAEQGHNVTVVTVLEPTITHKN----I 71
            :||:..:||:...|            ||.:....:.:.|.::.|||||:........:.|    :
Human    26 VVLSGNVLIWPTDG------------SHWLNIKIILEELIQRNHNVTVLASSATLFINSNPDSPV 78

  Fly    72 NLVTVPMTKEEIKQRSETIGAKQKNTSSNRFISILNMSGQMDSMLRKMADVLKDQR--------- 127
            |...:|            :..|:.|               :||::..|..:..|.|         
Human    79 NFEVIP------------VSYKKSN---------------IDSLIEHMIMLWIDHRPTPLTIWAF 116

  Fly   128 VKELYLNKDNHFDLVI---SGYFMNDYQLGFARKVNAPVVVLAPSPPSQMLNSLIG--------- 180
            .|||....|..|.:.|   .|...|...:...:|....|:|   :.|..:...|:.         
Human   117 YKELGKLLDTFFQINIQLCDGVLKNPKLMARLQKGGFDVLV---ADPVTICGDLVALKLGIPFMY 178

  Fly   181 ----NPHDKVEKEKG-------------------MTFGQRLDSYISSLLYGIFLRQIDQRNRQYY 222
                :|...||:..|                   ||||:|:.:.||..|.....:........||
Human   179 TLRFSPASTVERHCGKIPAPVSYVPAALSELTDQMTFGERIKNTISYSLQDYIFQSYWGEWNSYY 243

  Fly   223 NEIFGDDPTMPEYTDILRNTSLVFFCSHAASEGPIRPSVPAAIEIGGIQIKDKPDPLPKNLEKFL 287
            ::|.|...|:.|   .:....:....::...|.| ||.:|....:||:..| ...||||.:|:|:
Human   244 SKILGRPTTLCE---TMGKAEIWLIRTYWDFEFP-RPYLPNFEFVGGLHCK-PAKPLPKEMEEFI 303

  Fly   288 -GNATHGAILLSLGSNVQGSHIKADTVKKIFSVLSNLKQRVIWKWDDLDKTPGK-SDNILYSRWL 350
             .:..:|.::.||||.|:  ::..:....|.|.|:.:.|:|:|::.  .|.|.. .:|.....|:
Human   304 QSSGKNGVVVFSLGSMVK--NLTEEKANLIASALAQIPQKVLWRYK--GKKPATLGNNTQLFDWI 364

  Fly   351 PQDDILAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAMVKSGFGLTLSLLTLEE 415
            ||:|:|.||..|.||.|.|..||.||.|||.||:.:|:|.|||.|...|...|..:.::|.|:..
Human   365 PQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLNTMTS 429

  Fly   416 EPFRAAVLEILSNPKYSQRVVKFSSLYRDRPASARESLIFWTEYVIRHHGAAHLQSPLVHMDFIA 480
            ....:|:..:::.|.|.:..::.|.::.|:|....:..:||.|:|:||.||.||:.....:.:..
Human   430 VDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQ 494

  Fly   481 ANNLDIYALIGAISIGLLLMLKKVVQ---ITCRRLRTKLNKVKKQ 522
            .::||:   ||.:.:.:...:..|:|   .:|::. .|:.|.||:
Human   495 YHSLDV---IGFLLVCVTTAIFLVIQCCLFSCQKF-GKIGKKKKR 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 115/480 (24%)
UGT2A2NP_001099147.2 UDPGT 30..524 CDD:278624 134/547 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.