DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and UGT2B28

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_444267.1 Gene:UGT2B28 / 54490 HGNCID:13479 Length:529 Species:Homo sapiens


Alignment Length:500 Identity:136/500 - (27%)
Similarity:228/500 - (45%) Gaps:72/500 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SHLIISMSVAKILAEQGHNVTVVTVLEPTITHKN----INLVTVP--MTKEE----IKQRSETIG 91
            ||.:...::.|.|.::||.|||:......:...|    :.|...|  :||.|    |.|:.:...
Human    34 SHWMNMKTILKELVQRGHEVTVLASSASILFDPNDAFTLKLEVYPTSLTKTEFENIIMQQVKRWS 98

  Fly    92 AKQKNTSSNRFISILNMSGQMDSMLRKMA-DVLKDQRV-KELYLNKDNHFDLVISGYFMNDYQLG 154
            ..||::....|.....:..:...:.|... ||:.:::| |:|   :::.||::.:..|....:| 
Human    99 DIQKDSFWLYFSQEQEILWEFHDIFRNFCKDVVSNKKVMKKL---QESRFDIIFADAFFPCGEL- 159

  Fly   155 FARKVNAPVVVLAPSPPSQMLNSLIGNPHDKVEKEKG-------------------MTFGQRLDS 200
            .|..:|.|.|.           ||...|...:|:..|                   |||.:|:.:
Human   160 LAALLNIPFVY-----------SLCFTPGYTIERHSGGLIFPPSYIPVVMSKLSDQMTFMERVKN 213

  Fly   201 YISSLLYGIFLRQIDQRN-RQYYNEIFGDDPTMPE---YTDI-LRNTSLVFFCSHAASEGPIRPS 260
            .|..|.:..:.:..|.:. .|:|:|:.|...|:.|   ..|| |...|..|...|        |.
Human   214 MIYVLYFDFWFQMCDMKKWDQFYSEVLGRPTTLFETMGKADIWLMRNSWSFQFPH--------PF 270

  Fly   261 VPAAIEIGGIQIKDKPDPLPKNLEKFL-GNATHGAILLSLGSNVQGSHIKADTVKKIFSVLSNLK 324
            :|....:||:..| ...||||.:|:|: .:..:|.::.||||.:  |::.|:....|.:.|:.:.
Human   271 LPNIDFVGGLHCK-PAKPLPKEMEEFVQSSGENGVVVFSLGSVI--SNMTAERANVIATALAKIP 332

  Fly   325 QRVIWKWDDLDKTPGKSDNILYSRWLPQDDILAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVF 389
            |:|:|::|. :|......|....:|:||:|:|..|..:.||.|.|..||.||.|||.||:.:|:|
Human   333 QKVLWRFDG-NKPDALGLNTRLYKWIPQNDLLGLPKTRAFITHGGANGIYEAIYHGIPMVGIPLF 396

  Fly   390 GDQPGNAHAMVKSGFGLTLSLLTLEEEPFRAAVLEILSNPKYSQRVVKFSSLYRDRPASARESLI 454
            .|||.|...|...|..:.|...|:.......|:..::::|.|.:.|:|.|.:..|:|.......:
Human   397 WDQPDNIAHMKAKGAAVRLDFHTMSSTDLLNALKTVINDPSYKENVMKLSIIQHDQPVKPLHRAV 461

  Fly   455 FWTEYVIRHHGAAHLQSPLVHMDFIAANNLDIYALIGAISIGLLL 499
            ||.|:|:.|.||.||:.....:.:...::||:        ||.||
Human   462 FWIEFVMCHKGAKHLRVAARDLTWFQYHSLDV--------IGFLL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 121/455 (27%)
UGT2B28NP_444267.1 UDPGT 24..525 CDD:278624 135/499 (27%)
egt <269..506 CDD:223071 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150534
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.