DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and Ugt1a10

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_964003.2 Gene:Ugt1a10 / 394430 MGIID:3580642 Length:530 Species:Mus musculus


Alignment Length:535 Identity:149/535 - (27%)
Similarity:250/535 - (46%) Gaps:58/535 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLIYGAQGANILGLFPSLSPSHLIISMSVAKILAEQGHNVTVVTVLEPTIT---HKNINLV---- 74
            ||..|...|..|.:.| :..||......|.:.|.::||.|.||.   |.::   .|::|..    
Mouse    17 LLASGLVQAGRLLVVP-MDGSHWFDMQMVVEKLIQRGHEVVVVI---PEVSWRLGKSLNCTVKTY 77

  Fly    75 TVPMTKEEIKQRSETIGAKQKNTSSNRFISILNMS--GQMDSMLRKMADVLKDQRVKELYLNKDN 137
            :|..|.|::.:..:.....|..|......|.:..|  |..:.|......:..|:::.| || |..
Mouse    78 SVSHTLEDLDREFKYFTYTQWKTPEQSIRSFMTGSARGFFELMFSHSRGLFNDKKLVE-YL-KQR 140

  Fly   138 HFDLVISGYFMNDYQ---LGFARKVNAPVVVLA--------------PSPPSQMLNSLIGNPHDK 185
            .||.|    |::.:.   |..|:.::.|.|:.|              ||     |.|.:.....|
Mouse   141 SFDAV----FLDPFDVCGLIVAKYLSLPSVIFARLSFCYYLEEGAQCPS-----LLSYVPRLFSK 196

  Fly   186 VEKEKGMTFGQRLDSYISSLLYGIFLRQIDQRNRQYYNEIFGDDPTMPEYTDILRNTSLVFFCSH 250
            ....  |||.:|:.::...:...:|.....:...:..:|:.....||   ||:....|:....:.
Mouse   197 YTDT--MTFKERVWNHYMYIEDYVFCPYFFKTAVEIASEVLQTPVTM---TDLFSPVSIWLLRTD 256

  Fly   251 AASEGPIRPSVPAAIEIGGIQ-IKDKPDPLPKNLEKFLGNAT--HGAILLSLGSNVQGSHIKADT 312
            ...|.| ||.:|..:.:||:. ::.|  ||.|..|.:: ||:  ||.::.||||.|  |.|....
Mouse   257 FVLEFP-RPVMPNMVFVGGMNCLQGK--PLSKEFEAYV-NASGEHGIVVFSLGSMV--SEIPEKK 315

  Fly   313 VKKIFSVLSNLKQRVIWKWDDLDKTPGKSDNILYSRWLPQDDILAHPSVKLFINHAGKGGISEAQ 377
            ..:|...|..:.|.|:|::.. .:....:.|.:..:||||:|:|.||..:.||.|:|..||.|..
Mouse   316 AMEIAEALGRIPQTVLWRYTG-TRPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGI 379

  Fly   378 YHGKPMLSLPVFGDQPGNAHAMVKSGFGLTLSLLTLEEEPFRAAVLEILSNPKYSQRVVKFSSLY 442
            .:|.||:.:|:||||..||..|...|.|:||::|.:..:....|:..:::|..|.:.:::.|||:
Mouse   380 CNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLH 444

  Fly   443 RDRPASARESLIFWTEYVIRHHGAAHLQSPLVH-MDFIAANNLDIYALIGAISIGLLLMLKKVVQ 506
            :|||....:..:||.|||:||.||.||: |..| :.:...::||:...:.||.:.::.::.|...
Mouse   445 KDRPIEPLDLAVFWVEYVMRHKGAPHLR-PAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCA 508

  Fly   507 ITCRRLRTKLNKVKK 521
            ..||:......:|||
Mouse   509 YGCRKCFGGKGRVKK 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 123/459 (27%)
Ugt1a10NP_964003.2 egt 14..502 CDD:223071 143/512 (28%)
UDPGT 26..521 CDD:278624 142/522 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.