DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and T19H12.12

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001024147.2 Gene:T19H12.12 / 3565072 WormBaseID:WBGene00044282 Length:153 Species:Caenorhabditis elegans


Alignment Length:137 Identity:33/137 - (24%)
Similarity:53/137 - (38%) Gaps:23/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LTLLIYGAQGANILGLFPSLSPSHLIISMSVAKILAEQGHNVTV-------VTVLEPTITHKNIN 72
            |::|.:....:.||...|....||:.....||.|:|:.||:||:       :..|:..:.:|||.
 Worm     9 LSILFFKCHSSKILIFNPIYGFSHVKFISKVADIIADHGHHVTLFQPYHIALKNLDGLVKNKNIE 73

  Fly    73 LVTVPMTKEEIKQRSE----------------TIGAKQKNTSSNRFISILNMSGQMDSMLRKMAD 121
            ::....|..|...::|                .|||............|..|....|..:.|:..
 Worm    74 ILNYHPTHYEELLKAEPQAFSFFWDSHLVGNPVIGAFLMPKLIGGEFKITAMEVLSDRNMLKLQF 138

  Fly   122 VLKDQRV 128
            |||..|:
 Worm   139 VLKHARL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 31/127 (24%)
T19H12.12NP_001024147.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.