DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and Ugt3a2

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_038959826.1 Gene:Ugt3a2 / 294793 RGDID:1564365 Length:454 Species:Rattus norvegicus


Alignment Length:488 Identity:116/488 - (23%)
Similarity:212/488 - (43%) Gaps:99/488 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ITHKNINLVTVPMTKEEIKQRSETIGAKQKNTSSNRFISILNMSGQMDSMLRKMADVLKDQRVKE 130
            |.|..::|....:...:::....||            :.|....|.:.:.|....|:::      
  Rat    16 IMHYRVDLCPQKVKLNKLQFEHHTI------------VKIHRHFGDLCNHLLSRKDIME------ 62

  Fly   131 LYLNKDNHFDLVISGYFMNDY-------------------QLGF----ARKVNAPVVVLAPSPPS 172
             :| |:.:||||:  :...||                   ||||    .::|....|.:..|..:
  Rat    63 -FL-KNANFDLVL--FESVDYCSSLIVEKLGKQFVLFLAFQLGFMDFELQRVPLSYVPVYGSGLT 123

  Fly   173 QMLNSLIGNPHDKVEKEKGMTFGQRLDSYISSLLYGI------FLRQIDQRNRQYYNEIFGDDPT 231
            ..                 |.|..|:.:::  :.:.:      .|.|.|...::::.|  |..|.
  Rat   124 DQ-----------------MDFWGRVKNFL--MFFDLSRKQREILSQYDSTIQEHFAE--GSRPV 167

  Fly   232 MPEYTDILRNTSLVFF-CSHAASEGPIRPSVPAAIEIGGIQIKDKP-DPLPKNLEKFL---GNAT 291
            :   :|:|....|.|. |..|....  ||..|..:.:||  :.||| ..:|::||.|:   |:: 
  Rat   168 L---SDLLLKAELWFVNCDFAFEFA--RPLFPNIVYVGG--LLDKPVQSIPQDLENFITQFGDS- 224

  Fly   292 HGAILLSLGSNVQGSHIKADTVKKIFSVLSNLKQRVIWKWDD--LDKTPGKSDNILYSRWLPQDD 354
             |.:|::||:.......| :.:|::.:..::|.|.|||...|  ..|....:.|:....||||.|
  Rat   225 -GFVLVALGTVATKFQTK-EIIKEMNNAFAHLPQGVIWACKDSHWPKDVTLAPNVKIMDWLPQTD 287

  Fly   355 ILAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAMVKSGFGLTLSLLTLEEEPFR 419
            :|||||::||:.|.|...::||..||.||:.:..|.|||.|...:.....|:::.:.||:.|.|.
  Rat   288 LLAHPSIRLFVTHGGMNSVNEAIQHGVPMVGILFFSDQPENMIRVEAKTIGVSIQIQTLKAETFA 352

  Fly   420 AAVLEILSNPKYSQRVVKFSSLYRDRPASARESLIFWTEYVIRHHGAAHL-----QSPLVHMDFI 479
            ..:.|::.:.:|....:....:....|.:..:.|..|.:::::..|||||     |.|. |..::
  Rat   353 RTMKEVIEDKRYKSAAMASKIIRHSHPLTPSQRLEGWIDHILQTGGAAHLKPYAFQQPW-HEQYL 416

  Fly   480 AANNLDIYALIGAISIGLLLMLKKVVQITCRRL 512
                ||::..:..:::|.:.:..||:....|.|
  Rat   417 ----LDVFLFLLGLTLGTVWLCVKVLGAVMRYL 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 100/425 (24%)
Ugt3a2XP_038959826.1 Glycosyltransferase_GTB-type 49..419 CDD:415824 103/415 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.