DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and Ugt2b7

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_775445.2 Gene:Ugt2b7 / 286989 RGDID:708417 Length:529 Species:Rattus norvegicus


Alignment Length:519 Identity:138/519 - (26%)
Similarity:239/519 - (46%) Gaps:87/519 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LSPSHLIISMSVAKILAEQGHNVTVV-----TVLEPTITHKNINLV--TVPMT--KEEIKQ---- 85
            |..||.:....:...|.::||.|||:     ..|:|   .|...||  |.|.|  .:|:::    
  Rat    31 LEYSHWMNLKIILDELVQRGHEVTVLRPSSSVFLDP---KKASGLVYETFPTTSNNDEVEKFFTQ 92

  Fly    86 --RSETIGAKQKNTSSNRFISILNMSGQM-DSMLRKMADVLKDQRVKELYLNKDNHFDLVIS--- 144
              .:.|... .|.|....:.|:..|.||. |..|:...:|:.::.:  :...|::.||:|:|   
  Rat    93 WVNTWTYDV-PKYTCLRYYPSLNKMFGQFSDLWLQLCREVVSNKHL--MAKLKESQFDVVLSDAV 154

  Fly   145 -----------------------GYFMNDYQLGFARKVNAPVVVLAPSPPSQ---MLNSLIGNPH 183
                                   ||.:..|..|            .|.|||.   :|:.|.|.  
  Rat   155 GPCGELIAEILQLPFVYSLRFGIGYGIEKYSAG------------QPFPPSYVPIILSGLSGQ-- 205

  Fly   184 DKVEKEKGMTFGQRLDSYISSLLYGIFLRQIDQRN-RQYYNEIFGDDPTMPEYTDILRNTSLVFF 247
                    |||.:|:::.:..|.:..:......:: ..:::||.|...||   .|.::...:...
  Rat   206 --------MTFMERVENMLCLLYFDFWFESFPAKDWDPFFSEILGRPTTM---VDTMKKAEIWLI 259

  Fly   248 CSHAASEGPIRPSVPAAIEIGGIQIKDKPDPLPKNLEKFL-GNATHGAILLSLGSNVQGSHIKAD 311
            .|:...|.| |||:|....:||:..: ...||||.:|.|. .:..||.::.||||.::  :|..:
  Rat   260 RSYWDLEFP-RPSLPNIEFVGGLHCQ-PAKPLPKEMEDFAQSSGEHGVVVFSLGSMIR--NITQE 320

  Fly   312 TVKKIFSVLSNLKQRVIWKWDDLDKTPGK-SDNILYSRWLPQDDILAHPSVKLFINHAGKGGISE 375
            ....|.|.|:.:.|:|.|:::  .|.|.. ..|....:|:||:|:|.||..|.|:.|.|..||.|
  Rat   321 RANTIASALAQIPQKVFWRFE--GKKPDTLGPNTRVFKWIPQNDLLGHPKTKAFVTHGGANGIYE 383

  Fly   376 AQYHGKPMLSLPVFGDQPGNAHAMVKSGFGLTLSLLTLEEEPFRAAVLEILSNPKYSQRVVKFSS 440
            :.:||.||:.:|:|.:|..|...||..|..::|...|:.......|:..:::.|.|.::|:..|:
  Rat   384 SIHHGIPMVGIPLFAEQRDNVAHMVAKGAAVSLDFHTMSSSDLLNALKAVINKPSYKKKVMWLSA 448

  Fly   441 LYRDRPASARESLIFWTEYVIRHHGAAHLQSPLVH-MDFIAANNLDIYALIGAISIGLLLMLKK 503
            ::.|:|....:..:||.|:|:||.||.||: ||.| :.:...::||:...:.|..:.::|:..|
  Rat   449 IHHDQPLKPLDRAVFWIEFVMRHKGAKHLR-PLAHNLAWYQYHSLDVIGFLLACVLAIVLLAVK 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 120/469 (26%)
Ugt2b7NP_775445.2 UDPGT 24..527 CDD:278624 138/519 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.