DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and Ugt2b

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_113721.5 Gene:Ugt2b / 24862 RGDID:3936 Length:530 Species:Rattus norvegicus


Alignment Length:520 Identity:141/520 - (27%)
Similarity:253/520 - (48%) Gaps:92/520 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SHLIISMSVAKILAEQGHNVTVVT-----VLEP-TITHKNINLVTVPMTKEEIKQRSETIGAKQK 95
            ||.:....:...|.::||.|||:.     .|:| ..:.....:.:..::|:|::           
  Rat    34 SHWMNIKIILDELVQRGHEVTVLKPSAYFFLDPKKSSDLKFEIFSTSISKDELQ----------- 87

  Fly    96 NTSSNRFISILNM-------------SGQMDSMLRKMA----DVLKDQRVKELYLNK--DNHFDL 141
                |.||.:|::             |..:.:::.:.:    .:.||....:..:.|  ::.||:
  Rat    88 ----NHFIKLLDVWTYELPRDTCLSYSPILQNLVYEFSYFYLSICKDAVSNKQLMTKLQESKFDV 148

  Fly   142 VIS------GYFMND-------YQLGFA--RKVNAPV--VVLAPSPPSQMLNSLIGNPHDKVEKE 189
            :.:      |..:.:       |.|.|:  .|:...:  .:|.||....:|:.|.|.        
  Rat   149 LFADPVASCGDLIAELLHIPFLYSLSFSPGHKLEKSIGKFILPPSYVPVILSGLAGK-------- 205

  Fly   190 KGMTFGQRLDSYISSLLYGIFLRQIDQRNRQ---YYNEIFGDDPTMPEYTDILRNTSLVFFCSHA 251
              |||..|:.:.|..|.:..:...:  |:::   :|:||.|...|:.|   .:....:....|:.
  Rat   206 --MTFIDRVKNMICMLYFDFWFEIL--RHKEWDTFYSEILGRPTTVDE---TMSKVEIWLIRSYW 263

  Fly   252 ASEGPIRPSVPAAIEIGGIQIKDKPDPLPKNLEKFL-GNATHGAILLSLGSNVQGSHIKADTVKK 315
            ..:.| .|::|....|||:..| ...||||::|:|: .:..||.::.||||.|  |::..:....
  Rat   264 DLKFP-HPTLPNVDYIGGLHCK-PAKPLPKDMEEFVQSSGEHGVVVFSLGSMV--SNMTEEKANA 324

  Fly   316 IFSVLSNLKQRVIWKWDDLDKTPGK-SDNILYSRWLPQDDILAHPSVKLFINHAGKGGISEAQYH 379
            |...|:.:.|:|:||:|  .|||.. ..|....:||||:|||.||..|.|:.|.|..|:.||.||
  Rat   325 IAWALAQIPQKVLWKFD--GKTPATLGPNTRVYKWLPQNDILGHPKTKAFVTHGGANGLYEAIYH 387

  Fly   380 GKPMLSLPVFGDQPGNAHAMVKSGFGLTLSLLTLEEEPFRAAVLEILSNPKYSQRVVKFSSLYRD 444
            |.||:.:|:|||||.|...||..|..::|::.|:.:..|.:|:.|::.||.|.:.|:..|:::.|
  Rat   388 GIPMIGIPLFGDQPDNIAHMVAKGAAVSLNIRTMSKLDFLSALEEVIDNPFYKKNVMLLSTIHHD 452

  Fly   445 RPASARESLIFWTEYVIRHHGAAHLQSPLVH-MDFIAANNLDI-------YALIGAISIGLLLML 501
            :|....:..:||.|:::||.||.||: ||.| :.:...::||:       :|:|.|:::..||.:
  Rat   453 QPMKPLDRAVFWIEFIMRHKGAKHLR-PLGHNLPWYQYHSLDVIGFLLTCFAVIAALTVKCLLFM 516

  Fly   502  501
              Rat   517  516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 122/465 (26%)
Ugt2bNP_113721.5 UDPGT 24..527 CDD:278624 141/520 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.