DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and C03A7.13

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001343693.1 Gene:C03A7.13 / 182143 WormBaseID:WBGene00015371 Length:425 Species:Caenorhabditis elegans


Alignment Length:459 Identity:107/459 - (23%)
Similarity:181/459 - (39%) Gaps:97/459 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RTKSYFVIVLALTLLIYGAQGANILGLFPSLSPSHLIISMSVAKILAEQGHNVTVVTVLEPTITH 68
            ||...|::.|:|...:...  :|::....::..|||....|:...|.|:||.|.||.|       
 Worm     3 RTSILFILFLSLVSTLVNT--SNVVFFINAIGKSHLDFGDSLIDSLVERGHVVDVVIV------- 58

  Fly    69 KNINLVTVPMTKEEIKQRSETIGAKQKNTSSNRFISILNMSGQMDSMLRKMADVLKDQRVK---- 129
                             |...:.....|:.:::|..:.:::|...|.|..:|...:|:...    
 Worm    59 -----------------RVNNLVKGHGNSKASKFYELESINGSDWSKLSHLASPFEDRPFTFNGF 106

  Fly   130 ELYLNK--------------------DNHFDLVISGYFMNDY-QLGFARKVNAPVVVLAPSPPSQ 173
            ::| ||                    ...:|:.:...|  || .:|...|...|.:....:.|..
 Worm   107 QVY-NKIGNALCESALADQNLHAFLTSRQYDIGVVSVF--DYCGIGMLVKSEVPSIATFNALPLL 168

  Fly   174 MLNSL-IGNPHDKVEKEKGMTFGQRLDSYISSLLYGIF-------------LRQIDQRNRQYYNE 224
            .:.:: :|.|:  :..:....|    .|:..|.|||.|             :..:.....:.:.:
 Worm   169 SIQTVTMGLPN--IASQDVPLF----YSFDLSTLYGKFWNLACWRFLNLIRIPSLKHEQEKIFQK 227

  Fly   225 IFGDDPTMPEYTDILRNTSLVFFCSHAASEGPIRPSVPAAIEIGGIQIKDKPDPLPKNLEKFLGN 289
            ::|||..|   .||:....:.|..|:...|.| ||.......||||.:|   ||...|::..:.:
 Worm   228 VYGDDFNM---DDIIDKVDITFVNSNEVLERP-RPLHHRIQYIGGINLK---DPKSVNIKVDVDS 285

  Fly   290 ATHGAILLSLGSNVQGSHIKADTVKKIFSVLSNLKQ-RVIWKWDDLDKTPGKS------DNILYS 347
            :.      :.|:.:..|......|:....|.....: ..:||:   :..||:.      .|::..
 Worm   286 SD------NFGTQIPSSVYPRYAVRNFVKVFKKYPEYAFLWKY---NVQPGEEKLFENVGNVILL 341

  Fly   348 RWLPQDDILAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAMVKSGFGLTLSLLT 412
            .||||.|:|..|.|..||:|.|....|||.|.|||::::|:|.|||.||...|..|....|:...
 Worm   342 DWLPQTDLLYDPRVIGFISHVGLNSFSEASYSGKPIIAIPLFADQPYNARNGVARGTTYLLNKSK 406

  Fly   413 LEEE 416
            |.||
 Worm   407 LTEE 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 102/438 (23%)
C03A7.13NP_001343693.1 UDPGT 43..>414 CDD:330975 97/417 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.