DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and ugt2b1

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001170809.1 Gene:ugt2b1 / 100384895 ZFINID:ZDB-GENE-100402-1 Length:527 Species:Danio rerio


Alignment Length:551 Identity:145/551 - (26%)
Similarity:252/551 - (45%) Gaps:66/551 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VIVLALTLLIYGAQGANILGLFPSLSPSHLIISMSVAKILAEQGHNVTVVTVLEP---------- 64
            |..|:|..:....|..|||..:  ...||.|....|...|.::|||   ||||.|          
Zfish     5 VCFLSLLTVFSAGQCGNILVWY--TEGSHWINLKIVLDTLLDRGHN---VTVLMPDGALFMKAKE 64

  Fly    65 --TITHKNINLVTVPMTKEEIKQRSETIGAKQKNTSS-----NRFISILNMSGQMDSMLRKMADV 122
              ..::::.::.|.....::...........:...|:     .:|..:|  |...|..|.....:
Zfish    65 SDRFSYQHFSVSTSAQDMQDFLDEFLHFSVFELENSNLLQIQMKFFDLL--SKHQDMSLSYCDGI 127

  Fly   123 LKDQRVKELYLNKDNHFDLVISG--YFMNDYQLGFARKVNAPVVV-----LA----------PSP 170
            ||...:.:..  |...||:::|.  |..:|.   .|.::|.|:|.     ||          |:|
Zfish   128 LKSPELMDKL--KKGKFDVLLSDPMYPCSDI---VAEELNVPLVYTFRFSLAHTMERMCGQIPAP 187

  Fly   171 PSQMLNSLIGNPHDKVEKEKGMTFGQRLDSYISSLLYGIFLRQIDQRNRQYYNEIFGDDPTMPEY 235
            ||.:       |....:....|:|.:|:.|.:..|....|.|.|.:|...||.|..| .||  .|
Zfish   188 PSHV-------PGATSKLTDKMSFTERICSMLFYLSIDTFYRLIWKRFDNYYTEYLG-RPT--SY 242

  Fly   236 TDILRNTSLVFFCSHAASEGPIRPSVPAAIEIGGIQIKDKPDPLPKNLEKFL-GNATHGAILLSL 299
            .:::....:....::...|.| ||.||....|||:.. ....||||::|:|: .:...|.::.:|
Zfish   243 CEMMGRADIWLIRTYWDFEFP-RPFVPNFKYIGGLHC-TPAKPLPKDMEEFVQSSGDDGIVVFTL 305

  Fly   300 GSNVQGSHIKADTVKKIFSVLSNLKQRVIWKWDDLDKTPGKSDNILYSRWLPQDDILAHPSVKLF 364
            ||.:  ..:..:...:|.|.|:.:.|:|:|::.. :|.....:|....:|:||:|:|.||..:.|
Zfish   306 GSMI--DKVPKEMSNRIASALAQIPQKVLWRYGG-EKPDTLGENTRIYKWMPQNDLLGHPKTRAF 367

  Fly   365 INHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAMVKSGFGLTL-SLLTLEEEPFRAAVLEILSN 428
            |.|.|..||.||.|||.||:.:|:|||||.|...|...|..:.: |:.:::.:.....:..::::
Zfish   368 ITHGGTNGIYEAIYHGVPMVGIPLFGDQPDNMVHMTTRGAAVVVDSIKSMQPQELVDKLNTVIND 432

  Fly   429 PKYSQRVVKFSSLYRDRPASARESLIFWTEYVIRHHGAAHLQSPLVHMDFIAANNLDIYALIGAI 493
            |.|.:..::.|.::.|||....:..:||.|:|:|:.||.||:....::.:...:.||::|.:..:
Zfish   433 PSYKENAMRLSRIHHDRPMKPLDESVFWIEFVMRNKGAKHLRVEAHNLTWYQYHCLDVFAFLTTV 497

  Fly   494 SIGLLLMLKKVVQITCRR--LRTKLNKVKKQ 522
            ...:|.:..|:.:....|  .|:| .|.||:
Zfish   498 LTLVLYICSKMAKFFIMRCCFRSK-RKSKKE 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 121/466 (26%)
ugt2b1NP_001170809.1 UDPGT 20..523 CDD:278624 138/530 (26%)
egt <264..497 CDD:223071 73/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.