DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RtGEF and ARHGEF4

DIOPT Version :9

Sequence 1:NP_001097184.2 Gene:RtGEF / 35306 FlyBaseID:FBgn0015803 Length:1310 Species:Drosophila melanogaster
Sequence 2:NP_001354422.1 Gene:ARHGEF4 / 50649 HGNCID:684 Length:1876 Species:Homo sapiens


Alignment Length:495 Identity:109/495 - (22%)
Similarity:202/495 - (40%) Gaps:89/495 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVQAE--YSFMGSNNDELCFQKGDVITVTQREDGGWWEGTLNDKTGWFPSNYV-------NECKV 61
            ||.||  :..:..::.||.|:.||||.|....:..||.|.:.|..||||:::|       .....
Human  1382 VVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGEGWFPASFVRLRVNQDEPADD 1446

  Fly    62 QLPLTETIRPPE---EIQ----EYRSVVLKDLLDSERAHVAELQGLLENFL-EPMQQTQILSQDE 118
            ..||.......:   |.|    :.|:.|:.::|.:||.::..|:.:.|.:: :..::..:.|:::
Human  1447 DAPLAGNSGAEDGGAEAQSSKDQMRTNVINEILSTERDYIKHLRDICEGYVRQCRKRADMFSEEQ 1511

  Fly   119 YAQLMCNFVEIVRTHEDLLIQIEECNDR-------VGKLFLTSAPLMKKVHQA-------YCAAH 169
            ...:..|..:|.|..:..:..:|:..:|       :|..||.        |||       ||..|
Human  1512 LRTIFGNIEDIYRCQKAFVKALEQRFNRERPHLSELGACFLE--------HQADFQIYSEYCNNH 1568

  Fly   170 PKAIVILDKYKDELEKYM----------ERQGAATPGLLVLTTGLSKPFRRLDKYSAMLQELERH 224
            |.|.|.|.:. .:|.||:          :....:..|.|:      .|.:::.||...|.||.::
Human  1569 PNACVELSRL-TKLSKYVYFFEACRLLQKMIDISLDGFLL------TPVQKICKYPLQLAELLKY 1626

  Fly   225 MESSHPDRGDTQRSVAVYKDIAATCSATRRQKEL--ELQVLTGPVRGWQGQELST-LGDIIHMGS 286
            ....|.|..|.:.::...|::|...:..:|:.|.  ::......:..|:|::|.. ..::|:.|.
Human  1627 THPQHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQWQSSIEDWEGEDLLVRSSELIYSGE 1691

  Fly   287 VA----VGADHRDRYFVLFPQTLLFLSVS-QRMSAFIYEGKLPLTGIIVNRLEDTD------ALK 340
            :.    ..|..:.|.|.||...|::.... .|.....|:|:|.:.|:.|..|||..      ::|
Human  1692 LTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDVLYYKGRLDMDGLEVVDLEDGKDRDLHVSIK 1756

  Fly   341 NAFEISSPLIDRIVAVC-QGPNEANKWVELLNANNPSLPMGIKRQLSNLSNSSL----GHLNAAH 400
            |||.:..........:| :.|.:..:|::........:.:.   |.:..|.:.|    ..|||: 
Human  1757 NAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLD---QETGFSITELQRKQAMLNAS- 1817

  Fly   401 LSQHLDSRGYCTRFSLCAYYSSPPCHVRPLRVTLPPSNYP 440
             .|.:..:....         ..||::...:....|||.|
Human  1818 -KQQVTGKPKAV---------GRPCYLTRQKHPALPSNRP 1847

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RtGEFNP_001097184.2 SH3_PIX 6..58 CDD:212810 21/60 (35%)
RhoGEF 79..249 CDD:238091 42/194 (22%)
PH_Cool_Pix 281..376 CDD:269932 24/106 (23%)
ARHGEF4NP_001354422.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.