DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RtGEF and ARHGEF9

DIOPT Version :9

Sequence 1:NP_001097184.2 Gene:RtGEF / 35306 FlyBaseID:FBgn0015803 Length:1310 Species:Drosophila melanogaster
Sequence 2:NP_001340852.1 Gene:ARHGEF9 / 23229 HGNCID:14561 Length:529 Species:Homo sapiens


Alignment Length:414 Identity:93/414 - (22%)
Similarity:178/414 - (42%) Gaps:81/414 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DQPLVVQAEYSFMGSNNDELCFQKGDVITVTQREDGGWWEGTLNDKTGWFPSNYV-----NECKV 61
            |..:..:|.:..:...|.||.|:.||||.|....:..||.|.::|:.||||:::|     .|.:|
Human    21 DSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQEDEV 85

  Fly    62 QL-----------PLTETI---RPPEEIQEYRSVVLKDLLDSERAHVAELQGLLENFLEPMQQTQ 112
            :.           |.::.:   ||.:...:.|:.|:.:::.:||.::..|:.:.|.:|:..::.:
Human    86 EEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRR 150

  Fly   113 ILSQDEYAQLMC-NFVEIVRTHEDLLIQIEE--CND-----RVGKLFLTSAPLMKKVHQ------ 163
            .:..||..:::. |..:|.|.....:..:|:  .||     .:|..||.        ||      
Human   151 DMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLE--------HQDGFWIY 207

  Fly   164 -AYCAAHPKAIVILDK-YKDE-----------LEKYMERQGAATPGLLVLTTGLSKPFRRLDKYS 215
             .||..|..|.:.|.| .||.           |::.::   .|..|.|:      .|.:::.||.
Human   208 SEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMID---IAIDGFLL------TPVQKICKYP 263

  Fly   216 AMLQELERHMESSHPDRGDTQRSVAVYKDIAATCSATRRQKELE----LQVLTGPVRGWQGQE-L 275
            ..|.||.::....|.|......::||.:::  |.....|::.||    :......|..|:|:: |
Human   264 LQLAELLKYTAQDHSDYRYVAAALAVMRNV--TQQINERKRRLENIDKIAQWQASVLDWEGEDIL 326

  Fly   276 STLGDIIHMGSVA-----VGADHRDRYFVLFPQTLLFLSVSQRMSAFIYEGKLPLTGIIVNRLED 335
            ....::|:.|.:|     .|.:.:..:|:...|.:|......|.....|:|::.:....|..:||
Human   327 DRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMDKYEVVDIED 391

  Fly   336 ------TDALKNAFEISSPLIDRI 353
                  ..::||||::.:...:.|
Human   392 GRDDDFNVSMKNAFKLHNKETEEI 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RtGEFNP_001097184.2 SH3_PIX 6..58 CDD:212810 19/56 (34%)
RhoGEF 79..249 CDD:238091 42/196 (21%)
PH_Cool_Pix 281..376 CDD:269932 18/84 (21%)
ARHGEF9NP_001340852.1 SH3_ARHGEF9 20..81 CDD:212908 20/59 (34%)
RhoGEF 120..299 CDD:214619 42/197 (21%)
PH_Collybistin_ASEF 304..443 CDD:269931 24/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.