DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and SLF1

DIOPT Version :9

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_010803.3 Gene:SLF1 / 852127 SGDID:S000002923 Length:447 Species:Saccharomyces cerevisiae


Alignment Length:201 Identity:45/201 - (22%)
Similarity:89/201 - (44%) Gaps:51/201 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KQERAIIRQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLST--DLSEIVAALN 111
            |...:|..|:|:||.:.||..|:|||.:..|..||::|:|::..|.|:.:||.  |.:.|:|:: 
Yeast   270 KSIESIKNQIEFYFSEENLKTDEFLRSKFKKANDGFIPMSLIGKFYRMVNLSLGGDPNLILASM- 333

  Fly   112 KSEEGLVEISEDKLSLRRHPERPIPEHNEERRKEIQ------ERTAYAKGF-PLDSQISELLDFA 169
                                 |.:.:|.|....||.      .:...|..| ||::......::|
Yeast   334 ---------------------REVLQHKETNHLEIALGSIEGAQKNMADDFNPLENYFIRRENWA 377

  Fly   170 -----ANYDKVVNLTMRKHYDK-----PTKSYKFKG--SIFLTFETKDQAKAFLEQEKIVYKERE 222
                 :|:|:..:.|.:.:.:|     ...:|.:.|  :.|.:.|...::::        |.:.|
Yeast   378 EYAMESNFDENDDETEKYNIEKLLGPNDLDNYSYMGYPNFFPSNENGKKSQS--------YDQGE 434

  Fly   223 LLRKWQ 228
            :.|:::
Yeast   435 ISRQFE 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 24/81 (30%)
RRM1_La 150..226 CDD:240737 15/88 (17%)
RRM_SF 263..338 CDD:302621
SLF1NP_010803.3 LHP1 3..443 CDD:227520 45/201 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I2987
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.