Sequence 1: | NP_477014.1 | Gene: | La / 35305 | FlyBaseID: | FBgn0011638 | Length: | 390 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010803.3 | Gene: | SLF1 / 852127 | SGDID: | S000002923 | Length: | 447 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 201 | Identity: | 45/201 - (22%) |
---|---|---|---|
Similarity: | 89/201 - (44%) | Gaps: | 51/201 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 KQERAIIRQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLST--DLSEIVAALN 111
Fly 112 KSEEGLVEISEDKLSLRRHPERPIPEHNEERRKEIQ------ERTAYAKGF-PLDSQISELLDFA 169
Fly 170 -----ANYDKVVNLTMRKHYDK-----PTKSYKFKG--SIFLTFETKDQAKAFLEQEKIVYKERE 222
Fly 223 LLRKWQ 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
La | NP_477014.1 | LARP_3 | 47..129 | CDD:153397 | 24/81 (30%) |
RRM1_La | 150..226 | CDD:240737 | 15/88 (17%) | ||
RRM_SF | 263..338 | CDD:302621 | |||
SLF1 | NP_010803.3 | LHP1 | 3..443 | CDD:227520 | 45/201 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 48 | 1.000 | Domainoid score | I2987 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22792 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.100 |