DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and LHP1

DIOPT Version :9

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_010232.1 Gene:LHP1 / 851509 SGDID:S000002209 Length:275 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:70/255 - (27%)
Similarity:124/255 - (48%) Gaps:40/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IRQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEEGLVE 119
            ::|||:||.:.|...|:|||....|| |||||:|.:.||.|:... ..:.:::.||..||  ::|
Yeast    34 LKQVEFYFSEFNFPYDRFLRTTAEKN-DGWVPISTIATFNRMKKY-RPVDKVIEALRSSE--ILE 94

  Fly   120 ISEDKLSLRRHPERPIPEHNEERRKEIQERTAYAKGFPLD----SQISELLD----FAANYDKVV 176
            :|.|..:::|.....:......|.:: .:||.....||.:    |||.||.:    |.....::.
Yeast    95 VSADGENVKRRVPLDLTAARNARIEQ-NQRTLAVMNFPHEDVEASQIPELQENLEAFFKKLGEIN 158

  Fly   177 NLTMRKHYDKPTKSYKFKGSIFLTFETKDQAKAFLE--------QEKIVYKEREL--LRKWQVDY 231
            .:.:|:.:    ::.||.|::.:.|:|..:.:|||:        .|.:.|:.::|  |.|.|.|.
Yeast   159 QVRLRRDH----RNKKFNGTVLVEFKTIPECEAFLKSYSNDDESNEILSYEGKKLSVLTKKQFDL 219

  Fly   232 LKE--KQEEYAQKNEKRKNKKEAKPEPAFELPKNAIVVFEGAPETSSREEIREAFEKIKD 289
            .:|  |.:.::.::......|: |..|.|  |||        .:.:.:||.:|....|.|
Yeast   220 QREASKSKNFSGRSRSFNGHKK-KNLPKF--PKN--------KKKNGKEESKEDSSAIAD 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 28/73 (38%)
RRM1_La 150..226 CDD:240737 22/93 (24%)
RRM_SF 263..338 CDD:302621 6/27 (22%)
LHP1NP_010232.1 LHP1 1..>244 CDD:227520 60/219 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345368
Domainoid 1 1.000 48 1.000 Domainoid score I2987
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2962
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002882
OrthoInspector 1 1.000 - - otm46772
orthoMCL 1 0.900 - - OOG6_102594
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R649
SonicParanoid 1 1.000 - - X1665
TreeFam 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.