DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and SRO9

DIOPT Version :9

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_009893.2 Gene:SRO9 / 850320 SGDID:S000000542 Length:434 Species:Saccharomyces cerevisiae


Alignment Length:260 Identity:62/260 - (23%)
Similarity:101/260 - (38%) Gaps:86/260 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETPSVEAQEEV--AQPAEAQVLEAKNGDAKKDPAPAAEEAAGGFTKQERAIIRQVEYYFGDANLN 68
            :.|.|:.|::.  .||    ||.|.|.                       |.||:||||.:.||.
Yeast   242 QQPMVKLQQQFYPVQP----VLMAINN-----------------------IARQIEYYFSEENLT 279

  Fly    69 RDKFLREQIGKNEDGWVPLSVLVTFKRLASLS--TDLSEIVAALNK---SEEGLVEISEDKLSLR 128
            .|.:||.::.|  ||:.|||::..|.|:.::|  .|.:.|:|||.:   :|...|.::|..|:  
Yeast   280 VDNYLRSKLSK--DGFAPLSLISKFYRVVNMSFGGDTNLILAALREIVANEAATVNVAEGTLA-- 340

  Fly   129 RHPERPIPEHNEERRKEIQERTAYAK-GFPLDSQISELLDFAANYDKVVNLTMRKHYDKPTKSYK 192
                          .||....|..|| ..|||                      |::   .:|..
Yeast   341 --------------AKEGDNVTGEAKEPSPLD----------------------KYF---VRSKS 366

  Fly   193 FKGSIFLTFETKDQAKAFLEQEKIVYKERELLRKWQVDYLKEKQEEYAQKNEKRKNKKEAKPEPA 257
            :...:..||||:..    :|:|.:    .:.|.::.:......|:|.....|....::|.|.:.|
Yeast   367 WSNWLPETFETEIN----IEKELV----GDALDQFMISLPPVPQQEEESSTELASQEQETKEDSA 423

  Fly   258  257
            Yeast   424  423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 30/86 (35%)
RRM1_La 150..226 CDD:240737 15/76 (20%)
RRM_SF 263..338 CDD:302621
SRO9NP_009893.2 LHP1 1..434 CDD:227520 62/260 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.