DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and SRO9

DIOPT Version :10

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_009893.2 Gene:SRO9 / 850320 SGDID:S000000542 Length:434 Species:Saccharomyces cerevisiae


Alignment Length:260 Identity:62/260 - (23%)
Similarity:101/260 - (38%) Gaps:86/260 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETPSVEAQEEV--AQPAEAQVLEAKNGDAKKDPAPAAEEAAGGFTKQERAIIRQVEYYFGDANLN 68
            :.|.|:.|::.  .||    ||.|.|.                       |.||:||||.:.||.
Yeast   242 QQPMVKLQQQFYPVQP----VLMAINN-----------------------IARQIEYYFSEENLT 279

  Fly    69 RDKFLREQIGKNEDGWVPLSVLVTFKRLASLS--TDLSEIVAALNK---SEEGLVEISEDKLSLR 128
            .|.:||.::.|  ||:.|||::..|.|:.::|  .|.:.|:|||.:   :|...|.::|..|:  
Yeast   280 VDNYLRSKLSK--DGFAPLSLISKFYRVVNMSFGGDTNLILAALREIVANEAATVNVAEGTLA-- 340

  Fly   129 RHPERPIPEHNEERRKEIQERTAYAK-GFPLDSQISELLDFAANYDKVVNLTMRKHYDKPTKSYK 192
                          .||....|..|| ..|||                      |::   .:|..
Yeast   341 --------------AKEGDNVTGEAKEPSPLD----------------------KYF---VRSKS 366

  Fly   193 FKGSIFLTFETKDQAKAFLEQEKIVYKERELLRKWQVDYLKEKQEEYAQKNEKRKNKKEAKPEPA 257
            :...:..||||:..    :|:|.:    .:.|.::.:......|:|.....|....::|.|.:.|
Yeast   367 WSNWLPETFETEIN----IEKELV----GDALDQFMISLPPVPQQEEESSTELASQEQETKEDSA 423

  Fly   258  257
            Yeast   424  423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 30/86 (35%)
RRM1_La 150..226 CDD:409733 15/76 (20%)
RRM2_La 263..338 CDD:409957
SRO9NP_009893.2 LHP1 1..434 CDD:227520 62/260 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.