DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and LARP1b

DIOPT Version :9

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_201411.2 Gene:LARP1b / 836742 AraportID:AT5G66100 Length:453 Species:Arabidopsis thaliana


Alignment Length:139 Identity:48/139 - (34%)
Similarity:67/139 - (48%) Gaps:28/139 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PAPAAEEAAGGFTKQE-----------RAIIRQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSV 89
            |:|......|.|..|.           ..|:.||||||...||:||:.||:|:  |::||||:.|
plant   310 PSPDPMGLVGPFPLQPMYFRNFDAILYNKILTQVEYYFSADNLSRDEHLRDQM--NDEGWVPVRV 372

  Fly    90 LVTFKRLASLSTDLSEIVAALNKSEEGLVEISE---------DKLSLRRHPERPIP----EHNEE 141
            :..|:|||.|:.::..|:.||..||  :|||..         ||..|.|.|.|..|    .:|..
plant   373 IAAFRRLAELTNNIQTILEALRSSE--VVEIQGETLRRRGDWDKYLLPREPSRSGPAAGASNNAS 435

  Fly   142 RRKEIQERT 150
            ...:|:..|
plant   436 LVSQIESMT 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 38/101 (38%)
RRM1_La 150..226 CDD:240737 1/1 (100%)
RRM_SF 263..338 CDD:302621
LARP1bNP_201411.2 LAM 336..409 CDD:153396 33/76 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3807
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.