DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and LARP1a

DIOPT Version :9

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001190354.1 Gene:LARP1a / 832242 AraportID:AT5G21160 Length:833 Species:Arabidopsis thaliana


Alignment Length:357 Identity:65/357 - (18%)
Similarity:139/357 - (38%) Gaps:94/357 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IIRQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEEGLV 118
            :::||||||.|.||..|.:|...:  :|:||||..::..|||:.:::.|:..||.||..|..  |
plant   282 VLKQVEYYFSDENLENDHYLISLM--DEEGWVPTKIIAGFKRVKAMTMDVDFIVYALGFSNS--V 342

  Fly   119 EISEDKLSLRRHPERPIPEHNEERRKEIQERTAYAKGFPLDSQISELLDFA-ANYDKVVNLTMRK 182
            |:..|                     :|::|..::...|...:.:...... .:.|...::|...
plant   343 EVQGD---------------------QIRK
RDKWSDWIPASKKSTSAETIGDGDKDSPKSITSGD 386

  Fly   183 HYDKPTK---------------------SYKFKGSIFLTFETKDQAKAFLEQEKIVYKERELLRK 226
            ::..|:|                     :|| .|::          |:..::::.|   .:|...
plant   387 NFGNPSKGSSKPTVSDFSSEGAQSSRTNNYK-SGNL----------KSSADEKRNV---EDLSND 437

  Fly   227 WQVDYLKEKQEEYAQKNEKRKNKKEAKPEPAFELPKNAIVVFEGAPETSSREEIREAFEKIKDFE 291
            :...:|.:::.:...::.::.....:|.           :.:|........::|:         :
plant   438 FSNTFLLDEELDLEHRSPRKSGLSMSKS-----------IEYEDDDMAVDDQDIQ---------K 482

  Fly   292 VAYIEFAKGETKGS-VRLTEADAAEKYIAK-VEEGKLKFKDEVSLSLRKATEEEEKEFIDKAIEF 354
            :..:....|::.|: :..|||....|.:|. :.:|...|:.|  |..:::...:....:|     
plant   483 LVIVTQNSGKSDGAGIGGTEAKNIPKELASTINDGLYYFEQE--LKKKRSGRRKNNSHLD----- 540

  Fly   355 MKKRRDFTRNKGKRFNRKRHGGNDHKHGGGKK 386
               .:|.....|:..|.|. |.|...:.||::
plant   541 ---TKDGKIKSGEGLNTKL-GENSAANDGGEE 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 28/74 (38%)
RRM1_La 150..226 CDD:240737 11/97 (11%)
RRM_SF 263..338 CDD:302621 13/76 (17%)
LARP1aNP_001190354.1 LAM 279..351 CDD:153396 29/93 (31%)
DM15 670..710 CDD:128927
DM15 712..749 CDD:128927
DM15 750..785 CDD:128927
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.