DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and LARP1c

DIOPT Version :10

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_567991.1 Gene:LARP1c / 829743 AraportID:AT4G35890 Length:523 Species:Arabidopsis thaliana


Alignment Length:103 Identity:35/103 - (33%)
Similarity:57/103 - (55%) Gaps:14/103 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEEGLVEI 120
            :|::|||.|.||..|.:||..:  |.:|:|||.|:..||::|.|:.::.:||.||..|..  ||:
plant   375 KQIQYYFSDENLITDIYLRGFM--NNEGFVPLRVVAGFKKVAELTDNIQQIVEALQNSPH--VEV 435

  Fly   121 SEDKLS---------LRRHPERPIPEHNEERRKEIQER 149
            ..|.:.         |||:|....|: :.:|...:.:|
plant   436 QGDFIRKRDNWQNWVLRRNPTGSGPQ-SVDRADAVAKR 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 29/81 (36%)
RRM1_La 150..226 CDD:409733 35/103 (34%)
RRM2_La 263..338 CDD:409957
LARP1cNP_567991.1 LHP1 <182..448 CDD:227520 28/76 (37%)
LAM 372..442 CDD:153396 28/70 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.