DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and Larp7

DIOPT Version :9

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_038959070.1 Gene:Larp7 / 686883 RGDID:1592474 Length:578 Species:Rattus norvegicus


Alignment Length:425 Identity:121/425 - (28%)
Similarity:193/425 - (45%) Gaps:97/425 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVAETPSVEAQEEVAQPAEAQVLEAKNGDAKKDPAPAAEEAAGGFTKQERAIIRQVEYYFGDANL 67
            ||......|.|:.:.:..|      |..:.||..:...:..|.        |.:||:::||||||
  Rat     2 EVLRKMETENQKTMEESTE------KRKEEKKKRSRVKQVLAD--------IAKQVDFWFGDANL 52

  Fly    68 NRDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEEGLVEISEDKLSLRRHPE 132
            ::|:||||||.|:.||:|.:|:||:|.::..|:||...|..||..|  .:||:..:...:||  :
  Rat    53 HKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALKSS--SVVELDLEGTRIRR--K 113

  Fly   133 RPIPEHNEERRKEIQERTAYAKGFPLD---SQISELLDFAANYDKVVNLTMRKHYDKPTKSYKFK 194
            :|:    .||.|:.:|||.|.:..|.:   |.|..:.....|   ||.::: .|| |.|...  |
  Rat   114 KPL----GERPKDEEERTVYVELLPKNVTHSWIERVFGKCGN---VVYISI-PHY-KSTGDP--K 167

  Fly   195 GSIFLTFETKDQAKAFLE-----QEKIVYKE---RELLRKWQVDYLKEKQEEYAQKNEKRKNKKE 251
            |..|:.||||:||...:|     .|:...|.   .:.::...:..|:..:|:..:|.:|.:.|||
  Rat   168 GFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPSLRVAEEKKKKKKKKGRIKKE 232

  Fly   252 AKPE--------------PAFELPKNAIVVFEGAPETSSREEIREAFEKIKDFEVAYIEFAKGET 302
            ...:              .|.:.|:.|   .||: |..:.|..::..:|.|..:       |.||
  Rat   233 ESVQAKELVVDSSSSGVSKATKRPRTA---SEGS-EAETPEAPKQPAKKKKKRD-------KVET 286

  Fly   303 KGSVRLTEADAAEKYIAKVEE-------GKLKFK----------DEVS---LSLRKATEEEEKEF 347
            .|   |.|:.|.::..:..|:       .|||.:          .|||   ..|...:.|||||.
  Rat   287 GG---LPESKAGKRERSSAEDEDCLPPRPKLKKRAQKDGGGPAASEVSKEHRDLEFCSTEEEKEP 348

  Fly   348 IDKAIEFMKKRRDFTRNKGKRFNRKRHGGNDHKHG 382
            .|        |:..:.:||||.::|:| ...||.|
  Rat   349 GD--------RKGDSLSKGKRKHKKKH-KERHKMG 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 33/81 (41%)
RRM1_La 150..226 CDD:240737 24/86 (28%)
RRM_SF 263..338 CDD:302621 22/94 (23%)
Larp7XP_038959070.1 LARP_7 32..112 CDD:153401 34/89 (38%)
RRM1_LARP7 127..206 CDD:409732 24/85 (28%)
RRM2_LARP7 450..531 CDD:409958
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.