DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and larp6b

DIOPT Version :10

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001082877.1 Gene:larp6b / 565767 ZFINID:ZDB-GENE-041008-244 Length:471 Species:Danio rerio


Alignment Length:84 Identity:28/84 - (33%)
Similarity:48/84 - (57%) Gaps:4/84 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IIRQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEEGLV 118
            |..|:|.|..|.||:.|.||.:.:.:|:.|:|.|.:|.:||::..|:.|....:||...|.:  :
Zfish    65 IATQLENYLSDENLSDDAFLLKHVQRNKMGYVSLKLLTSFKKIRDLTRDWRTTLAAARTSPQ--L 127

  Fly   119 EISEDKLSLRRHPERPIPE 137
            |::|....:||  ..|:|:
Zfish   128 EVNEMGTKVRR--RTPVPD 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 24/74 (32%)
RRM1_La 150..226 CDD:409733
RRM2_La 263..338 CDD:409957
larp6bNP_001082877.1 LARP_6 62..138 CDD:153402 24/74 (32%)
RRM_SF 181..261 CDD:473069
SUZ-C <445..459 CDD:463745
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.