DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and larp6

DIOPT Version :9

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_012825802.1 Gene:larp6 / 493506 XenbaseID:XB-GENE-493801 Length:769 Species:Xenopus tropicalis


Alignment Length:306 Identity:70/306 - (22%)
Similarity:120/306 - (39%) Gaps:86/306 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SVEAQEEVAQPAEAQVLEAKNGDAKKDPAPAAEEAAGGFTK----------QE---------RAI 54
            |.|.:::     |..::||  ||..:|.:...::.:|..|.          |:         :.:
 Frog   322 SAENEDQ-----EKGLMEA--GDCSEDDSARQDKYSGAATSGGENDGDELDQDWKPPDAELIQKL 379

  Fly    55 IRQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEEGLVE 119
            |.|:|||..|.||.:|.||.:.:.:|:.|:|.:.:|.:||::..|:.|......||..|  .|:|
 Frog   380 ITQIEYYLSDENLEKDAFLLKHVRRNKMGFVSVKLLTSFKKVKHLTRDWRTTAYALRYS--NLLE 442

  Fly   120 ISEDKLSLRRHPERP-------------------IPEHN----EERRKEIQERTAYAKGFPLDSQ 161
            ::||...:||....|                   |||.|    |:....:||:.           
 Frog   443 LNEDNRKIRRKTPVPVFPSENLPSKMLLVYDLHFIPELNCLGKEQENGGMQEKV----------- 496

  Fly   162 ISELLDFAANYDKVVNLTMRK-HYDKPTKSYKFKGSIFLTFETKDQAKAFLEQEKIVYKERELL- 224
            :..||.....:..:.::.:.| ..|.|:...:| .|.:....|||.|....|:.:...|..:.. 
 Frog   497 MEHLLKSFGTFGVISSIRILKPGRDLPSDVKRF-SSRYSQVGTKDCAIVEFEEVEAAIKAHDTFN 560

  Fly   225 --------------------RKWQVDYLKEKQEEYAQKNEKRKNKK 250
                                :|.|.|..||:..:..:|| |..||:
 Frog   561 VESDTEDGLKVVLIGMKPPKKKIQKDKSKEEDSKNVRKN-KSLNKR 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 28/100 (28%)
RRM1_La 150..226 CDD:240737 13/97 (13%)
RRM_SF 263..338 CDD:302621
larp6XP_012825802.1 LARP_6 376..452 CDD:153402 26/77 (34%)
RRM_LARP6 467..575 CDD:240735 20/119 (17%)
SUZ-C 743..757 CDD:372374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.