DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and Larp4B

DIOPT Version :9

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_647793.1 Gene:Larp4B / 38399 FlyBaseID:FBgn0035424 Length:1531 Species:Drosophila melanogaster


Alignment Length:290 Identity:70/290 - (24%)
Similarity:105/290 - (36%) Gaps:99/290 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VEAQEEVAQPAEAQVLEAKNGDAKKDPAPAAEEAAGG------FTKQERAIIRQVEYYFGDANLN 68
            |..|..|..|...|:  ..||.|  ||...:..||||      ..|.::.:..|:||||...||.
  Fly   226 VPVQVPVQVPVPVQL--PANGSA--DPQQGSHNAAGGEEPNIPLDKLKQMLATQLEYYFSRENLA 286

  Fly    69 RDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEEGLVEISEDKLSLRRHPER 133
            .|.:|..|:  :.|.:||:..:..|..:..|:.|::.|...|.:|.    .:..|...||..|.|
  Fly   287 NDTYLLSQM--DSDQYVPIYTVARFNLVRKLTNDINLITEVLRESP----NVQVDDKGLRVRPNR 345

  Fly   134 PIPEHNEERR-----KEIQERTAYAKGFPLDSQISELL-----------DFAANYDKVVNLTMRK 182
                    :|     :||...|      ||| .:..|.           :||||           
  Fly   346 --------KRCIIILREISNNT------PLD-DVKALFSNESCPRPISCEFAAN----------- 384

  Fly   183 HYDKPTKSYKFKGSIFLTFETKDQAKAFLEQEKIVYKERELLRKWQVDYLKEKQEEYAQKNEKRK 247
                        .|.::|||:.:.|:.       .||           ||:|:.:|:        
  Fly   385 ------------NSWYITFESDEDAQK-------AYK-----------YLREEVKEF-------- 411

  Fly   248 NKKEAKPEPAFELPKNAIVVFEGAPETSSR 277
               :.||..|...||:.|...:..|:...|
  Fly   412 ---QGKPIMARIKPKSFINRIQAVPKNGYR 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 22/81 (27%)
RRM1_La 150..226 CDD:240737 16/86 (19%)
RRM_SF 263..338 CDD:302621 3/15 (20%)
Larp4BNP_647793.1 LARP_4_5_like 269..343 CDD:153400 22/79 (28%)
RRM_LARP4_5_like 348..423 CDD:240876 25/133 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456182
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.