DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and Achl

DIOPT Version :9

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001286419.1 Gene:Achl / 36605 FlyBaseID:FBgn0033936 Length:867 Species:Drosophila melanogaster


Alignment Length:324 Identity:74/324 - (22%)
Similarity:126/324 - (38%) Gaps:76/324 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PSVEAQEEV----AQPAEAQVLEAKNGDAKKDPA--PAAEEAAGGFTKQERAIIRQVEYYFGDAN 66
            |..|.::||    .|..|.|   ..|.....||:  |:.|.||        .|...||:||.:.:
  Fly   244 PPQEKEQEVPVHQEQDTEPQ---GPNEIDTLDPSLIPSEELAA--------EITDAVEFYFSNES 297

  Fly    67 LNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEEGLVEISEDKLSLRRHP 131
            :.:|.||.:.:.:|::|:|.|.::.:|||:..|:.:...:..|:.:... .:|:::....:||  
  Fly   298 ILKDAFLLKHVRRNKEGFVSLKLVSSFKRVRQLTREWKVVGDAVRRKSR-KIELNDVGTKVRR-- 359

  Fly   132 ERPIPEHNEERRKEIQERTAYAKGFPLDSQISELLDFAANYDKVVNLTMRKHYD--KPTKSYKFK 194
            ..|:|..:|    .:..||..|...|||                 .||:.|..|  .|.      
  Fly   360 IEPLPSFDE----TMPSRTIVACDLPLD-----------------KLTIEKVSDLFSPC------ 397

  Fly   195 GSIFLTFETKDQAKAFLEQEKIVYKERELLRK--WQVDYLKEKQ-----------EEYAQKNEKR 246
            |.|.|....|......::..:.:.|..||.:|  ..|:||:...           :.|.....|:
  Fly   398 GEIALIRILKPGMAIPVDVRQFMNKYPELQQKECALVEYLESSSARDARHLNGPFQVYEMVAPKK 462

  Fly   247 KNKKEAK----PEPAFELPKNAIVVFEGAPET------SSREEIREAFEKIK----DFEVAYIE 296
            |..|:|.    ..|...:.:|.....:...|.      |..|.:.:...|:|    ||:.:|.:
  Fly   463 KTGKKAAVIQIAAPVARMVENYRYYNDANYERSRGGSFSGHETVPDLRFKLKRNNSDFQPSYYQ 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 18/81 (22%)
RRM1_La 150..226 CDD:240737 17/77 (22%)
RRM_SF 263..338 CDD:302621 9/44 (20%)
AchlNP_001286419.1 LARP_6 282..359 CDD:153402 20/85 (24%)
RRM_LARP6 373..472 CDD:240735 27/121 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.