DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and Larp1

DIOPT Version :9

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_038943133.1 Gene:Larp1 / 303158 RGDID:1306683 Length:1073 Species:Rattus norvegicus


Alignment Length:364 Identity:80/364 - (21%)
Similarity:149/364 - (40%) Gaps:101/364 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IIRQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEEGLV 118
            |.||:||||...||.||.|||.::  :.||::|::::.:|.|:.:|:||:|.|.|||..|:  :|
  Rat   383 IKRQIEYYFSVDNLERDFFLRRKM--DADGFLPITLIASFHRVQALTTDISLIFAALKDSK--VV 443

  Fly   119 EISEDKLSLRRHPER-PIPEHNEERRKEIQERTAYAKGFPLDSQISELLDFA-ANYDKVVN---L 178
            |:.|:|:..|..||: |:|                  |.|       ::|:: .::.:::|   .
  Rat   444 EMVEEKVRRREEPEKWPLP------------------GPP-------IVDYSQTDFSQLLNCPEF 483

  Fly   179 TMRKHYDKPTKSYKFKGSIFLTFETKDQAKAFLEQEKIVYKERELLRKWQVDYLKEKQEEYAQKN 243
            ..|:||.|.|:|............||.:..:.|          :.|.|.....|.:...|...:.
  Rat   484 VPRQHYQKETESAPGSPRAVTPVPTKTEEVSNL----------KTLPKGLSASLPDLDSESWIEV 538

  Fly   244 EKRKNKKEAKP----EPAF--------ELPKNAIVVFEGAPETSSREEIREAF------------ 284
            :||.....|:|    ||.|        ::|...::    :.:...:||:...|            
  Rat   539 KKRPRPSPARPKKSEEPRFSHPTALPQQIPSQQLM----SKDQDEQEELDFLFDEEMEQMDGRKN 599

  Fly   285 ------EKIKDFEV---------------AYIEFAKGETKGSVRLTEADAAEKYIAKVEEGKLKF 328
                  ::..|:|:               .|:....|..:.....:.|..:.:....:.:|...:
  Rat   600 TFTAWSDEDSDYEIDDRDVNKILIVTQTPPYMRRHPGGDRTGNHTSRAKMSAELAKVINDGLFYY 664

  Fly   329 KDEVSLSLRKATEEEEKEF--IDKAIEFMKKRRDFTRNK 365
            :.::      .||:.|.|:  |.:.:|..||....:|.:
  Rat   665 EQDL------WTEKFEPEYSQIKQEVENFKKVNMISREQ 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 32/74 (43%)
RRM1_La 150..226 CDD:240737 14/79 (18%)
RRM_SF 263..338 CDD:302621 9/107 (8%)
Larp1XP_038943133.1 PHA03247 <95..291 CDD:223021
LHP1 <368..534 CDD:227520 53/189 (28%)
LARP_1_2 380..452 CDD:153403 32/72 (44%)
DM15 863..903 CDD:128927
DM15 904..942 CDD:128927
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.