DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and SPAC1527.03

DIOPT Version :9

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_594554.1 Gene:SPAC1527.03 / 2541645 PomBaseID:SPAC1527.03 Length:475 Species:Schizosaccharomyces pombe


Alignment Length:134 Identity:42/134 - (31%)
Similarity:71/134 - (52%) Gaps:27/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 QVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEEGLVEIS 121
            |:||||...||.:|.|||:.:  :::|:|||:.|.:|.|:.|.||||:.:.||...|:  :::::
pombe   332 QLEYYFSIENLCKDMFLRKHM--DDEGYVPLAFLASFNRIKSFSTDLNLLHAACKASD--IIDVA 392

  Fly   122 EDKLSLRRHPERPIPEHNEERRKEI--------QERTAY--AKGFPLDSQISELLDFAANYDKVV 176
            .|..|         |...:.||||.        :.|..:  || :|..:..|.:...|::   :.
pombe   393 IDLQS---------PMSIKVRRKETWSPWILPSESRLKFEMAK-YPQINSSSSMSPLASS---IS 444

  Fly   177 NLTM 180
            |||:
pombe   445 NLTI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 28/71 (39%)
RRM1_La 150..226 CDD:240737 8/33 (24%)
RRM_SF 263..338 CDD:302621
SPAC1527.03NP_594554.1 LHP1 4..473 CDD:227520 42/134 (31%)
LA 323..406 CDD:128955 30/86 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.