DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and sla1

DIOPT Version :9

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_593315.1 Gene:sla1 / 2541530 PomBaseID:SPAC57A10.10c Length:298 Species:Schizosaccharomyces pombe


Alignment Length:290 Identity:91/290 - (31%)
Similarity:129/290 - (44%) Gaps:64/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VEAQEE-VAQPAEAQVLEAKNGDAKKDPAPAAEEAAGGFTKQERAIIRQVEYYFGDANLNRDKFL 73
            ||:|:: .::..:.:..|.|..|.|||           .:..|..:::|||:||.|.||..||||
pombe    33 VESQKDTTSEEKKEETTEKKEDDGKKD-----------LSFDEAEVLKQVEFYFSDTNLPHDKFL 86

  Fly    74 REQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEEGLVEISEDKLSLRRHPERPIPEH 138
            .....|| |||||:..:..|||:.... .|..||.||.||.| |:|:.|....:|    |.||..
pombe    87 WTTSQKN-DGWVPIQTIANFKRMRRFQ-PLEAIVNALRKSPE-LLEVDEAGEKVR----RMIPLV 144

  Fly   139 NEERRKEIQERTAYAKGF---PLDSQISELLDFAANYDKVVNLTMRKHYDKPTKSYKFKGSIFLT 200
            ..: .|.:.||:.|.|||   ..|:||:....|..|...:..:.||:..||     |||||:|:.
pombe   145 RVD-NKSVMERSVYCKGFGDEKDDTQIALEKFFEENAGPISAVRMRRDDDK-----KFKGSVFVE 203

  Fly   201 FETKDQAKAFLEQEK---IVYKERELLRKWQVDYLKEKQE------------------------- 237
            |:..|.|..|||:.|   :.:.|.||....:.:|:..|.|                         
pombe   204 FKEPDVANKFLEKVKTAPLKWGEDELTIMSKKEYVDMKAELHKNDPPKFSSKRRRFDAFKEMDRQ 268

  Fly   238 ---EYAQKNEKRK-----NKKEAKPEPAFE 259
               :|:.:..|.|     |..|.||..|.|
pombe   269 RPGKYSNRGRKFKKQRSSNASEEKPSAASE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 34/81 (42%)
RRM1_La 150..226 CDD:240737 29/81 (36%)
RRM_SF 263..338 CDD:302621
sla1NP_593315.1 LHP1 1..298 CDD:227520 90/288 (31%)
LA_like_fungal 64..139 CDD:153398 35/81 (43%)
RRM1_La 155..232 CDD:240737 29/81 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I3340
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I1654
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002882
OrthoInspector 1 1.000 - - oto101140
orthoMCL 1 0.900 - - OOG6_102594
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R649
SonicParanoid 1 1.000 - - X1665
TreeFam 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.