DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and Larp1b

DIOPT Version :9

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001035489.2 Gene:Larp1b / 214048 MGIID:1914604 Length:541 Species:Mus musculus


Alignment Length:84 Identity:37/84 - (44%)
Similarity:57/84 - (67%) Gaps:5/84 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IIRQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEEGLV 118
            |.||:||||...||.||.|||.::  :|.|::|:|::..|.|:.:|:|:|:.|:.||..|.|  |
Mouse   425 IKRQIEYYFSTENLERDFFLRRKM--DEQGFLPISLIAGFHRVQALTTNLNLILEALKDSTE--V 485

  Fly   119 EISEDKLSLRRHPER-PIP 136
            ||.::|:..:..||: |||
Mouse   486 EIVDEKMRKKIEPEKWPIP 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 32/74 (43%)
RRM1_La 150..226 CDD:240737
RRM_SF 263..338 CDD:302621
Larp1bNP_001035489.2 LARP_2 422..494 CDD:153407 32/72 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.