DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment La and LARP4

DIOPT Version :9

Sequence 1:NP_477014.1 Gene:La / 35305 FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_011536131.1 Gene:LARP4 / 113251 HGNCID:24320 Length:732 Species:Homo sapiens


Alignment Length:395 Identity:69/395 - (17%)
Similarity:138/395 - (34%) Gaps:133/395 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEEGLVEI 120
            :|:|:.|...||::|.:|..|:  :.|.::|:..:...:.:..|:||...|:..|..|.  :|::
Human   133 KQLEFCFSRENLSKDLYLISQM--DSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSP--MVQV 193

  Fly   121 SEDKLSLRRHPERPIPEHNEERR-----KEIQERTAYAKGFPLDSQISELLDFAANYDKVVNLTM 180
            .|....:|       |.|   :|     :||.|.|      |:: ::..|.. :.|..||::.  
Human   194 DEKGEKVR-------P
SH---KRCIVILREIPETT------PIE-EVKGLFK-SENCPKVISC-- 238

  Fly   181 RKHYDKPTKSYKFKGSIFLTFET---KDQAKAFLEQEKIVYKERELLRKWQV------------- 229
                     .:....:.::||::   ..||..:|.:|...::.:.::.:.:.             
Human   239 ---------EFAHNSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAINTFFAKNGYRLM 294

  Fly   230 -----DYLKEKQEEYAQK-------NEKRK--------NKKEAKPEPAFELP------------- 261
                 .:..:.|.:||..       |..::        ......|.|.||.|             
Human   295 DSSIYSHPIQTQAQYASPVFMQPVYNPHQQYSVYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGF 359

  Fly   262 -------KNAIVVFEGAPETSSREEIREAFEKIKDFEVAYIEFAKGETKGSVRLTEAD------- 312
                   .||..:..|.|...:|  ::..|......|        ..|:|||.|.:..       
Human   360 NSPGSYKTNAAAMNMGRPFQKNR--VKPQFRSSGGSE--------HSTEGSVSLGDGQLNRYSSR 414

  Fly   313 --AAEKYIAKVEEGKLKFKDEVSLSLRKATEEEEKEFIDKAIEFMKKRRDFTRNKGKR--FNRKR 373
              .||::...|                  |..:|:.::.|....::..::....:|:|  |..:|
Human   415 NFPAERHNPTV------------------TGHQEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRR 461

  Fly   374 HGGND 378
            ...:|
Human   462 RREDD 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaNP_477014.1 LARP_3 47..129 CDD:153397 18/72 (25%)
RRM1_La 150..226 CDD:240737 12/78 (15%)
RRM_SF 263..338 CDD:302621 15/83 (18%)
LARP4XP_011536131.1 LARP_4 128..202 CDD:153404 19/79 (24%)
RRM_LARP4 207..283 CDD:241151 15/94 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.