powered by:
Protein Alignment CG10651 and CG42537
DIOPT Version :9
Sequence 1: | NP_001286095.1 |
Gene: | CG10651 / 35303 |
FlyBaseID: | FBgn0032853 |
Length: | 316 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001163530.1 |
Gene: | CG42537 / 8674074 |
FlyBaseID: | FBgn0260645 |
Length: | 90 |
Species: | Drosophila melanogaster |
Alignment Length: | 45 |
Identity: | 8/45 - (17%) |
Similarity: | 15/45 - (33%) |
Gaps: | 17/45 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KCIWLLFSTLYIQDTGASDKWCKADLCRGQHVLCDDNGNFESTCP 47
||: ...|:...|..:::|....| :.:||
Fly 63 KCL----KMKYLGCGGNQNRYCSLRHC-------------QRSCP 90
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10651 | NP_001286095.1 |
SCP_euk |
61..210 |
CDD:240180 |
|
CG42537 | NP_001163530.1 |
KU |
<53..89 |
CDD:294074 |
6/42 (14%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.