DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and PRY2

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_012938.3 Gene:PRY2 / 853882 SGDID:S000001721 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:161 Identity:32/161 - (19%)
Similarity:54/161 - (33%) Gaps:52/161 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 STCPKQAAAMVKMSWDMIALIVDKHNEYR--NKFAGGMDQNPKAARMTTIEWDPELAKVAD---- 102
            :|....|::....|.|....:|::||..|  :|..|            ::.|...||..|.    
Yeast   176 TTTQSTASSTQSSSSDFSTSMVNEHNTKRALHKDTG------------SLTWSDTLATYAQNYAD 228

  Fly   103 ------GLVRRCEPIRDQCAITPNYGHAEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQK 161
                  .||....|..:..|:  .||              ||      ..:|.|::..:..:...
Yeast   229 SYDCSGNLVHSGGPYGENLAL--GYG--------------TT------GSVDAWYNEITSYDYSN 271

  Fly   162 LFFSWTKNQQELSKNYFQVLRDRANRVGCAI 192
            ..||      |.:.::.||:....:.|||.:
Yeast   272 PGFS------ESAGHFTQVVWKGTSEVGCGL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 28/144 (19%)
PRY2NP_012938.3 CAP_PRY1-like 191..319 CDD:349403 29/146 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344568
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.