DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and PRY3

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:43/196 - (21%)
Similarity:67/196 - (34%) Gaps:51/196 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NFESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLV 105
            ||||.                  ::::||::|   |..:|..|       :.|...||..|....
Yeast    24 NFESD------------------VLNEHNKFR---ALHVDTAP-------LTWSDTLATYAQNYA 60

  Fly   106 RRCEPIRDQCAITPNYGHAEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQ 170
                   ||...:....|::..|. |......|...|    :|.|:...||.......||     
Yeast    61 -------DQYDCSGVLTHSDGPYG-ENLALGYTDTGA----VDAWYGEISKYNYSNPGFS----- 108

  Fly   171 QELSKNYFQVLRDRANRVGCAIVEYVRPALVHQLLKCVYN-CGVSLCE--EEDNPVYEDTDEEAA 232
             |.:.::.||:......:||. .:|..... :..:.|.|| .|..|.|  ||..|:.......::
Yeast   109 -ESTGHFTQVVWKSTAEIGCG-YKYCGTTW-NNYIVCSYNPPGNYLGEFAEEVEPLISTVSSSSS 170

  Fly   233 S 233
            |
Yeast   171 S 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 30/148 (20%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 37/175 (21%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344589
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.