DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and Crispld1

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001343480.1 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:308 Identity:59/308 - (19%)
Similarity:108/308 - (35%) Gaps:113/308 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YIQDTGASDKWCKADLCRGQHVLCDDNGNFESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAG 77
            |:.:.|   :|..|.. ||:..:.|:                    ||.: |:|.||:.|::.  
Mouse    39 YMDEDG---EWWTAKQ-RGKRAITDN--------------------DMQS-ILDLHNKLRSQV-- 76

  Fly    78 GMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYSLEKYFCMTTKKEA 142
                .|.|:.|..:.||.||.:.|:.....|.......::.|:.|. .:.....:|...|...:|
Mouse    77 ----YPTASNMEYMTWDVELERSAESWAEMCLWEHGPASLLPSIGQ-NLGAHWGRYRPPTFHVQA 136

  Fly   143 LRKQLDHWFDPNSKDEVQKLFFSWTKNQQE----------LSKNYFQVLRDRANRVGCAIVEYVR 197
                   |:     |||:...:.: :|:.:          :..:|.||:...::|:|||:     
Mouse   137 -------WY-----DEVRDFSYPY-ENECDPYCPFRCSGPVCTHYTQVVWATSSRIGCAV----- 183

  Fly   198 PALVHQL------------LKCVYN---------------------------CGVSLCEEEDNPV 223
             .|.|.:            |.|.|:                           |..:||.:|.:..
Mouse   184 -NLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGRPCSACPPSFGGGCRENLCYKEGSDR 247

  Fly   224 YEDTDEEAASECMKGSNKQYKNLCHKDELVKTCNGGSLFVEPENDYND 271
            |....||..:|..:..::.:      |..|:|.:       .::|.||
Mouse   248 YYTPREEETNEIERQQSQVH------DTHVRTRS-------DDSDRND 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 35/170 (21%)
Crispld1NP_001343480.1 CAP_CRISPLD1 62..207 CDD:349407 36/171 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281 5/35 (14%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841243
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.