DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and AT5G02730

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_195893.1 Gene:AT5G02730 / 831820 AraportID:AT5G02730 Length:205 Species:Arabidopsis thaliana


Alignment Length:197 Identity:43/197 - (21%)
Similarity:72/197 - (36%) Gaps:44/197 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NGNFESTC----PKQAAAMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPKAARM----TTIEWDP 95
            :|.|.||.    |...||..:.:          :...|||.:........|||:    :.:.||.
plant    26 SGEFPSTAGTSSPDTKAAAARAT----------NRGRRNKQSAEFLLAHNAARVASGASNLRWDQ 80

  Fly    96 ELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYSLEKYFCMTTKKEALRKQLDHWFDPN-SKDEV 159
            .||:.|.   :..:..:..|.:|    |:...|....:....::..:.|:.:|.|.|.: :.|.|
plant    81 GLARFAS---KWAKQRKSDCKMT----HSGGPYGENIFRYQRSENWSPRRVVDKWMDESLNYDRV 138

  Fly   160 QKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIVEYVRPALVHQLLKCVYNCG-VSLCEEEDNPV 223
            ..     |.....:..:|.|::......||||            ..||..|.| :.:||...:..
plant   139 AN-----TCKSGAMCGHYTQIVWRTTTAVGCA------------RSKCDNNRGFLVICEYSPSGN 186

  Fly   224 YE 225
            ||
plant   187 YE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 30/153 (20%)
AT5G02730NP_195893.1 SCP_PR-1_like 57..193 CDD:240181 33/156 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.