DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and AT4G31470

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_194875.1 Gene:AT4G31470 / 829274 AraportID:AT4G31470 Length:185 Species:Arabidopsis thaliana


Alignment Length:137 Identity:28/137 - (20%)
Similarity:45/137 - (32%) Gaps:47/137 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 HNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYSLEK 132
            ||..|.|.           |:..::|...||..|.   |.....|..|.:.    |:...|. |.
plant    58 HNILRAKL-----------RLPPLKWSNSLALYAS---RWARTRRGDCKLI----HSGGPYG-EN 103

  Fly   133 YFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSK------------NYFQVLRDRA 185
            .|..:.|         .|   ..:|.|.    :|....:...:            :|.|::..::
plant   104 LFWGSGK---------GW---TPRDAVA----AWASEMKYYDRRTSHCKANGDCLHYTQLVWKKS 152

  Fly   186 NRVGCAI 192
            :|:||||
plant   153 SRIGCAI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 28/137 (20%)
AT4G31470NP_194875.1 CAP_PR-1 51..185 CDD:349400 28/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.