DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and AT4G25780

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_194308.1 Gene:AT4G25780 / 828683 AraportID:AT4G25780 Length:190 Species:Arabidopsis thaliana


Alignment Length:180 Identity:39/180 - (21%)
Similarity:60/180 - (33%) Gaps:65/180 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CKADLCRGQHVLCD-DNGNFESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPKAAR 87
            || :||.|    || |:..|                      :.:||..|            |||
plant    41 CK-NLCPG----CDHDSLQF----------------------LFRHNLVR------------AAR 66

  Fly    88 M-TTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYSLEKYFCMTTKKEALRKQLDHWF 151
            . ..:.||..|...|.|...:   .|..||:..:..:.|.:.....|:....          :| 
plant    67 FEPPLIWDRRLQNYAQGWANQ---RRGDCALRHSVSNGEFNLGENIYWGYGA----------NW- 117

  Fly   152 DPNSKDEV-----QKLFFSWTKN---QQELSKNYFQVLRDRANRVGCAIV 193
              :..|.|     :|.|:.:..|   ..::..:|.|::.....|||||.|
plant   118 --SPADAVVAWASEKRFYHYGSNTCDAGQMCGHYTQIVWKSTRRVGCARV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 30/142 (21%)
AT4G25780NP_194308.1 CAP_PR-1 54..190 CDD:349400 31/162 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.