DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and AT3G19690

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:140 Identity:30/140 - (21%)
Similarity:54/140 - (38%) Gaps:32/140 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGH 123
            |:....::.|||.||:.  |:|         .:.||.|:|..|.....  :.|.| ||:..:.| 
plant    24 DLQQQFLEAHNEARNEV--GLD---------PLVWDDEVAAYAASYAN--QRIND-CALVHSNG- 73

  Fly   124 AEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKN-----QQELSKNYFQVLRD 183
                 ...:...|::.:.:.....:.|.:       :|.::.:..|     ......:|.||:..
plant    74 -----PFGENIAMSSGEMSAEDAAEMWIN-------EKQYYDYDSNTCNDPNGGTCLHYTQVVWK 126

  Fly   184 RANRVGCAIV 193
            ...|:|||.|
plant   127 NTVRLGCAKV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 29/138 (21%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 29/138 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.