DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and AT3G09590

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_187570.1 Gene:AT3G09590 / 820116 AraportID:AT3G09590 Length:186 Species:Arabidopsis thaliana


Alignment Length:176 Identity:36/176 - (20%)
Similarity:68/176 - (38%) Gaps:39/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 AAMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQC 115
            |...|:|.:.:    ..||:.|           .::.:.|:.||.:||:.||   :..:..:..|
plant    44 ARRAKLSREFL----QAHNDAR-----------VSSGVPTLGWDRDLARFAD---KWAKQRKSDC 90

  Fly   116 AITPNYGHAEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQV 180
            ::.    |:...|....::....|..:..|.:..||:.....:|:    :.|....::..:|.|:
plant    91 SMI----HSGGPYGENIFWHRRKKTWSPEKVVTRWFEERFNYDVK----TNTCAPGKMCGHYTQM 147

  Fly   181 LRDRANRVGCAIVEYVRPALVHQLLKCVYNCG-VSLCEEEDNPVYE 225
            :......||||.|            ||....| :.:||.:....||
plant   148 VWRETTAVGCARV------------KCHNGRGYLVVCEYDPRGNYE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 28/148 (19%)
AT3G09590NP_187570.1 CAP_PR-1 50..186 CDD:349400 34/170 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.