DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and PRB1

DIOPT Version :10

Sequence 1:NP_610029.2 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:139 Identity:27/139 - (19%)
Similarity:50/139 - (35%) Gaps:46/139 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYS 129
            |:.||:.|::...|           .::||..||..|.....:   ::..|.:.    |:...|.
plant    34 VNAHNQARSQIGVG-----------PMQWDEGLAAYARNYANQ---LKGDCRLV----HSRGPYG 80

  Fly   130 LEKYFCMTTKKEALRKQ---------LDHWFDPNSKDEVQKLFFSWTKNQ-QELSKNYFQVLRDR 184
                       |.|.|.         ::.|.:       :|..:::..|. ..:..:|.||:...
plant    81 -----------ENLAKSGGDLSGVAAVNLWVN-------EKANYNYDTNTCNGVCGHYTQVVWRN 127

  Fly   185 ANRVGCAIV 193
            :.|:|||.|
plant   128 SVRLGCAKV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_610029.2 CAP_euk 61..210 CDD:349399 27/139 (19%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 27/139 (19%)

Return to query results.
Submit another query.