DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and Pi16

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_076223.3 Gene:Pi16 / 74116 MGIID:1921366 Length:498 Species:Mus musculus


Alignment Length:190 Identity:45/190 - (23%)
Similarity:73/190 - (38%) Gaps:53/190 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGH-AEVS 127
            :||.||:||.:.      :|.|:.|..:.||.|||..|....::|.           :|| .|..
Mouse    38 MVDLHNQYRAQV------SPPASDMLQMRWDDELAAFAKAYAQKCV-----------WGHNKERG 85

  Fly   128 YSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGCA- 191
            ...|..|.:|.:...:...:.:|.:.:....    |.:.|.:..::..:|.||:..:..|:||. 
Mouse    86 RRGENLFAITDEGMDVPLAVGNWHEEHEYYN----FSTATCDPNQMCGHYTQVVWSKTERIGCGS 146

  Fly   192 ----IVEYVRPALVHQLLKC-------------------------VYNCGVSLCEEEDNP 222
                .::.|..|.:| ||.|                         .|:|..||||...||
Mouse   147 HFCETLQGVEEANIH-LLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLCEPMRNP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 37/176 (21%)
Pi16NP_076223.3 SCP_HrTT-1 35..168 CDD:240186 37/151 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..277 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.