DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_081294.1 Gene:Glipr1l1 / 69286 MGIID:1916536 Length:236 Species:Mus musculus


Alignment Length:221 Identity:47/221 - (21%)
Similarity:74/221 - (33%) Gaps:85/221 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 HNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYSLEK 132
            |||.|.|.      .|.||.|..:.||.:|||:|....|.|:...:.|.             .::
Mouse    49 HNELRRKV------QPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCI-------------KQR 94

  Fly   133 YFCM---------------TTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQ-QELSKNYFQVL 181
            |.|:               .|:.|.:   :.:|::       :..:|::..|. .|:..:|.||:
Mouse    95 YECLEDYDFIGENIYLGRIETQPEDV---VINWYN-------ESKYFNFDFNTCSEMCGHYTQVV 149

  Fly   182 RDRANRVGCAIVEYVRPAL---VHQLLKCVYN-------------------CGVSLCEEEDNPVY 224
            ..:..::|||:...  |.|   ...|..|.|:                   ||...||.      
Mouse   150 WAKTVKIGCAVSNC--PNLKGFSAGLFVCNYSPAGNFIGFRPYTRGDSCSMCGQKTCEN------ 206

  Fly   225 EDTDEEAASEC--MKGSNKQYKNLCH 248
                    |.|  |......:|..||
Mouse   207 --------SLCRPMNRKTPHHKAACH 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 36/160 (23%)
Glipr1l1NP_081294.1 SCP_GLIPR-1_like 40..181 CDD:240185 37/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841410
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.