DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and Crisp1

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001034482.2 Gene:Crisp1 / 654517 RGDID:1590757 Length:254 Species:Rattus norvegicus


Alignment Length:235 Identity:44/235 - (18%)
Similarity:79/235 - (33%) Gaps:86/235 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAI----------- 117
            |||.||.:|.      :.:|.|..|..:.|....|:.|..|.|.|:. .|..::           
  Rat    49 IVDTHNAFRR------NVSPPARNMLKMSWSSAAAENARILARYCDK-SDSDSLERRLPNTFCGE 106

  Fly   118 ---TPNYGHA-----EVSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELS 174
               ..||..:     |:.|:..|||           :...|  |::.|:::             :
  Rat   107 NMHMENYPSSWSNVIEIWYNESKYF-----------KYGEW--PSTDDDIE-------------T 145

  Fly   175 KNYFQVLRDRANRVGCAIVEYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGS 239
            .:|.|::...:..:||.:....|......|..|.|                         |.:|:
  Rat   146 YHYTQMVWASSYLIGCDVASCRRQKAATYLYVCHY-------------------------CHEGN 185

  Fly   240 NKQYKNLCHKD-----ELVKTCNGGSLFVEP---ENDYND 271
            ::...|:.:|:     :....|..| |...|   .::||:
  Rat   186 SQDTLNMPYKEGPPCQDCPNNCEDG-LCTNPCLYYDEYNN 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 33/164 (20%)
Crisp1NP_001034482.2 SCP 46..182 CDD:294090 34/190 (18%)
Crisp 200..254 CDD:285731 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344745
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.