DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and Crisp3

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 / 64827 RGDID:619846 Length:246 Species:Rattus norvegicus


Alignment Length:292 Identity:54/292 - (18%)
Similarity:91/292 - (31%) Gaps:120/292 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IQDTGASDKWCKADLCRGQHVLCDDNGNFESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGG 78
            :|||  :|:|.:            |..|..:|         |:|  :...|::|||:.|...   
  Rat    19 LQDT--TDEWDR------------DLENLSTT---------KLS--VQEEIINKHNQLRRTV--- 55

  Fly    79 MDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYSLEKYFC-----MTT 138
               :|..:.:..:|||.:....|.....||           .|.|:.:.:......|     |..
  Rat    56 ---SPSGSDLLRVEWDHDAYVNAQKWANRC-----------IYNHSPLQHRTTTLKCGENLFMAN 106

  Fly   139 KKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIVEYVRPALVHQ 203
            ...:....:..|:|       :.|.|               |......:||..:..|.       
  Rat   107 YPASWSSVIQDWYD-------ESLDF---------------VFGFGPKKVGVKVGHYT------- 142

  Fly   204 LLKCVYN------CGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCHKDELVKTCNGGSLF 262
              :.|:|      |||:.|  .|.|:                  :|..:||      .|.||:..
  Rat   143 --QVVWNSTFLVACGVAEC--PDQPL------------------KYFYVCH------YCPGGNYV 179

  Fly   263 VEPENDYNDGQ---------EENM-ENDYEFE 284
            ....:.|.:|:         |:.: .|..|:|
  Rat   180 GRLYSPYTEGEPCDSCPGNCEDGLCTNSCEYE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 25/153 (16%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 36/210 (17%)
Crisp 192..246 CDD:285731 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344829
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.